Human IL3/IL-3/MCGF ORF/cDNA clone-Lentivirus particle (NM_000588)
Cat. No.: vGMLP-IL-006
Pre-made Human IL3/IL-3/MCGF Lentiviral expression plasmid for IL3 lentivirus packaging, IL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IL-3/IL3/IL3/IL-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP-IL-006 | Human IL3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP-IL-006 |
| Gene Name | IL3 |
| Accession Number | NM_000588 |
| Gene ID | 3562 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 459 bp |
| Gene Alias | IL-3,MCGF,MULTI-CSF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCTCCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGATGAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCGCAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTGA |
| ORF Protein Sequence | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1027-Ab | Anti-IL3/ IL-3/ MCGF functional antibody |
| Target Antigen | GM-Tg-g-SE1027-Ag | IL3 protein |
| ORF Viral Vector | pGMLP000459 | Human IL3 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000287 | Human IL3 Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-006 | Human IL3 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-089 | Human IL3 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000459 | Human IL3 Lentivirus particle |
| ORF Viral Vector | vGMAP000287 | Human IL3 Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-006 | Human IL3 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-089 | Human IL3 Adenovirus particle |
Target information
| Target ID | GM-SE1027 |
| Target Name | IL-3/IL3 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3562 |
| Gene ID |
16187 (Mus musculus), 24495 (Rattus norvegicus), 280823 (Bos taurus), 3562 (Homo sapiens) 481497 (Canis lupus familiaris), 706946 (Macaca mulatta) |
| Gene Symbols & Synonyms | Il3,IL3,BPA,PSF,HCGF,Il-3,MCGF,Csfmu,IL-3,MULTI-CSF |
| Target Alternative Names | BPA,Csfmu,HCGF,Hematopoietic growth factor,IL-3,IL3,Il-3,Il3,Interleukin-3,MCGF,MULTI-CSF,Mast cell growth factor (MCGF),Multipotential colony-stimulating factor,P-cell-stimulating factor,PSF |
| Uniprot Accession |
P01586,P04823,P08700,P25140,P49875,Q9BDX4
Additional SwissProt Accessions: P01586,P04823,P49875,P08700,Q9BDX4,P25140 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, Apoptosis, JAK-STAT signaling pathway, Hematopoietic cell lineage, Fc epsilon RI signaling pathway, Pathways in cancer, Acute myeloid leukemia, Asthma |
| Gene Ensembl | ENSMUSG00000018914, ENSBTAG00000002140, ENSG00000164399, ENSMMUG00000016912 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


