Human CXCL12/IRH/PBSF ORF/cDNA clone-Adenovirus particle (NM199168)

Cat. No.: vGMAP000581

Pre-made Human CXCL12/IRH/PBSF Adenovirus for CXCL12 overexpression in-vitro and in-vivo. The CXCL12 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CXCL12-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CXCL12/SDF-1/CXCL12/IRH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000581 Human CXCL12 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000581
Gene Name CXCL12
Accession Number NM199168
Gene ID 6387
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 270 bp
Gene Alias IRH,PBSF,SCYB12,SDF1,TLSF,TPAR1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAACGCCAAGGTCGTGGTCGTGCTGGTCCTCGTGCTGACCGCGCTCTGCCTCAGCGACGGGAAGCCCGTCAGCCTGAGCTACAGATGCCCATGCCGATTCTTCGAAAGCCATGTTGCCAGAGCCAACGTCAAGCATCTCAAAATTCTCAACACTCCAAACTGTGCCCTTCAGATTGTAGCCCGGCTGAAGAACAACAACAGACAAGTGTGCATTGACCCGAAGCTAAAGTGGATTCAGGAGTACCTGGAGAAAGCTTTAAACAAGTAA
ORF Protein Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T04773-Ab Anti-SDF1/ CXCL12/ IRH functional antibody
    Target Antigen GM-Tg-g-T04773-Ag CXCL12 protein
    Cytokine cks-Tg-g-GM-T04773 chemokine (C-X-C motif) ligand 12 (CXCL12) protein & antibody
    ORF Viral Vector pGMLV000007 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMLV000955 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMLV002285 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMAD000581 Human CXCL12 Adenovirus plasmid
    ORF Viral Vector pGMAAV000139 Human CXCL12 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000581 Human CXCL12 Adenovirus plasmid
    ORF Viral Vector pGMPC001800 Human CXCL12 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000007 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMLV000955 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMLV002285 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMAD000581 Human CXCL12 Adenovirus particle
    ORF Viral Vector vGMAAV000139 Human CXCL12 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000581 Human CXCL12 Adenovirus particle


    Target information

    Target ID GM-T04773
    Target Name CXCL12/SDF-1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6387
    Gene ID 100049872 (Equus caballus), 20315 (Mus musculus), 24772 (Rattus norvegicus), 449622 (Canis lupus familiaris)
    493806 (Felis catus), 574334 (Macaca mulatta), 613811 (Bos taurus), 6387 (Homo sapiens)
    Gene Symbols & Synonyms CXCL12,Cxcl12,SDF1,Pbsf,Sdf1,Tlsf,Tpar1,Scyb12,SDF-1,IRH,PBSF,TLSF,TPAR1,SCYB12
    Target Alternative Names C-X-C motif chemokine 12,CXCL12,Cxcl12,IRH,Intercrine reduced in hepatomas (IRH,PBSF,Pbsf,Pre-B cell growth-stimulating factor (PBSF),SCYB12,SDF-1,SDF1,Scyb12,Sdf1,Stromal cell-derived factor 1,TLSF,TPAR1,Tlsf,Tpar1,hIRH),hSDF-1
    Uniprot Accession O62657,P40224,P48061
    Additional SwissProt Accessions: P40224,O62657,P48061
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway, Axon guidance, Leukocyte transendothelial migration, Intestinal immune network for IgA production, Regulation of actin cytoskeleton, Human cytomegalovirus infection, Pathways in cancer, Rheumatoid arthritis
    Gene Ensembl ENSECAG00000019551, ENSMUSG00000061353, ENSCAFG00845026834, ENSMMUG00000012181, ENSBTAG00000005077, ENSG00000107562
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.