Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human ADIPOQ/ACRP30/adiponectin ORF/cDNA clone-Adenovirus particle (BC096310)
Cat. No.: vGMAP000564
Pre-made Human ADIPOQ/ACRP30/adiponectin Adenovirus for ADIPOQ overexpression in-vitro and in-vivo. The ADIPOQ adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ADIPOQ-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
Adiponectin/ADIPOQ/ADIPOQ/ACRP30 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000564 | Human ADIPOQ Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000564 |
| Gene Name | ADIPOQ |
| Accession Number | BC096310 |
| Gene ID | 9370 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 735 bp |
| Gene Alias | ACRP30,adiponectin,APM-1,APM1,GBP28 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGTTGCTGGGAGCTGTTCTACTGCTATTAGCTCTGCCCGGTCATGACCAGGAAACCACGACTCAAGGGCCCGGAGTCCTGCTTCCCCTGCCCAAGGGGGCCTGCACAGGTTGGATGGCGGGCATCCCAGGGCATCCGGGCCATAATGGGGCCCCAGGCCGTGATGGCAGAGATGGCACCCCTGGTGAGAAGGGTGAGAAAGGAGATCCAGGTCTTATTGGTCCTAAGGGAGACATCGGTGAAACCGGAGTACCCGGGGCTGAAGGTCCCCGAGGCTTTCCGGGAATCCAAGGCAGGAAAGGAGAACCTGGAGAAGGTGCCTATGTATACCGCTCAGCATTCAGTGTGGGATTGGAGACTTACGTTACTATCCCCAACATGCCCATTCGCTTTACCAAGATCTTCTACAATCAGCAAAACCACTATGATGGCTCCACTGGTAAATTCCACTGCAACATTCCTGGGCTGTACTACTTTGCCTACCACATCACAGTCTATATGAAGGATGTGAAGGTCAGCCTCTTCAAGAAGGACAAGGCTATGCTCTTCACCTATGATCAGTACCAGGAAAATAATGTGGACCAGGCCTCCGGCTCTGTGCTCCTGCATCTGGAGGTGGGCGACCAAGTCTGGCTCCAGGTGTATGGGGAAGGAGAGCGTAATGGACTCTATGCTGATAATGACAATGACTCCACCTTCACAGGCTTTCTTCTCTACCATGACACCAACTGA |
| ORF Protein Sequence | MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T15572-Ab | Anti-ADIPO/ ADIPOQ/ ACDC functional antibody |
| Target Antigen | GM-Tg-g-T15572-Ag | ADIPOQ protein |
| ORF Viral Vector | pGMLV002165 | Human ADIPOQ Lentivirus plasmid |
| ORF Viral Vector | pGMAP000564 | Human ADIPOQ Adenovirus plasmid |
| ORF Viral Vector | vGMLV002165 | Human ADIPOQ Lentivirus particle |
| ORF Viral Vector | vGMAP000564 | Human ADIPOQ Adenovirus particle |
Target information
| Target ID | GM-T15572 |
| Target Name | Adiponectin/ADIPOQ |
|
Gene Group Identifier （Target Gene ID in Homo species) |
9370 |
| Gene ID |
100059500 (Equus caballus), 11450 (Mus musculus), 246253 (Rattus norvegicus), 282865 (Bos taurus) 403625 (Canis lupus familiaris), 554338 (Felis catus), 574212 (Macaca mulatta), 9370 (Homo sapiens) |
| Gene Symbols & Synonyms | ADIPOQ,Adipoq,ADID,Ad,APN,Acdc,Adid,apM1,30kDa,GBP28,adipo,Acrp30,APM1,ACRP30,ACDC,ADPN,APM-1,ADIPQTL1 |
| Target Alternative Names | 30 kDa adipocyte complement-related protein,30kDa,ACDC,ACRP30,ADID,ADIPOQ,ADIPQTL1,ADPN,APM-1,APM1,APN,Acdc,Acrp30,Ad,Adid,Adipocyte,Adipocyte complement-related 30 kDa protein (ACRP30),Adiponectin,Adipoq,Adipose most abundant gene transcript 1 protein (apM-1),C1q and collagen domain-containing protein,GBP28,Gelatin-binding protein,adipo,apM1 |
| Uniprot Accession |
Q15848,Q3Y5Z3,Q60994
Additional SwissProt Accessions: Q60994,Q3Y5Z3,Q15848 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | PPAR signaling pathway, Longevity regulating pathway, Adipocytokine signaling pathway, Type II diabetes mellitus, Alcoholic liver disease |
| Gene Ensembl | ENSECAG00000002962, ENSMUSG00000022878, ENSBTAG00000059085, ENSCAFG00845021949, ENSMMUG00000002684, ENSG00000181092 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.