Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CD79A/MB-1 ORF/cDNA clone-Adenovirus particle (BC113731)
Cat. No.: vGMAP000491
Pre-made Human CD79A/MB-1 Adenovirus for CD79A overexpression in-vitro and in-vivo. The CD79A adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CD79A-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CD79A/CD79a/CD79A/MB-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000491 | Human CD79A Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000491 |
| Gene Name | CD79A |
| Accession Number | BC113731 |
| Gene ID | 973 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 681 bp |
| Gene Alias | MB-1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCTGGGGGTCCAGGAGTCCTCCAAGCTCTGCCTGCCACCATCTTCCTCCTCTTCCTGCTGTCTGCTGTCTACCTGGGCCCTGGGTGCCAGGCCCTGTGGATGCACAAGGTCCCAGCATCATTGATGGTGAGCCTGGGGGAAGACGCCCACTTCCAATGCCCGCACAATAGCAGCAACAACGCCAACGTCACCTGGTGGCGCGTCCTCCATGGCAACTACACGTGGCCCCCTGAGTTCTTGGGCCCGGGCGAGGACCCCAATGGTACGCTGATCATCCAGAATGTGAACAAGAGCCATGGGGGCATATACGTGTGCCGGGTCCAGGAGGGCAACGAGTCATACCAGCAGTCCTGCGGCACCTACCTCCGCGTGCGCCAGCCGCCCCCCAGGCCCTTCCTGGACATGGGGGAGGGCACCAAGAACCGAATCATCACAGCCGAGGGGATCATCCTCCTGTTCTGCGCGGTGGTGCCTGGGACGCTGCTGCTGTTCAGGAAACGATGGCAGAACGAGAAGCTCGGGTTGGATGCCGGGGATGAATATGAAGATGAAAACCTTTATGAAGGCCTGAACCTGGACGACTGCTCCATGTATGAGGACATCTCCCGGGGCCTCCAGGGCACCTACCAGGATGTGGGCAGCCTCAACATAGGAGATGTCCAGCTGGAGAAGCCGTGA |
| ORF Protein Sequence | MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0216-Ab | Anti-CD79A/ IGA/ MB-1 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0216-Ag | CD79A VLP (virus-like particle) |
| ORF Viral Vector | pGMAP000491 | Human CD79A Adenovirus plasmid |
| ORF Viral Vector | vGMAP000491 | Human CD79A Adenovirus particle |
Target information
| Target ID | GM-MP0216 |
| Target Name | CD79A/CD79a |
|
Gene Group Identifier （Target Gene ID in Homo species) |
973 |
| Gene ID |
100052219 (Equus caballus), 100913063 (Rattus norvegicus), 101083127 (Felis catus), 12518 (Mus musculus) 281674 (Bos taurus), 484483 (Canis lupus familiaris), 722190 (Macaca mulatta), 973 (Homo sapiens) |
| Gene Symbols & Synonyms | CD79A,Cd79a,Cd79al,Iga,Ly54,mb-1,Ly-54,Igalpha,Ig-alpha,MB-1,IG-alpha,IGA,MB1,IGAlpha |
| Target Alternative Names | B-cell antigen receptor complex-associated protein alpha chain,CD79A,CD79a,Cd79a,Cd79al,IG-alpha,IGA,IGAlpha,Ig-alpha,Iga,Igalpha,Ly-54,Ly54,MB-1,MB-1 membrane glycoprotein,MB1,Membrane-bound immunoglobulin-associated protein,Surface IgM-associated protein,mb-1 |
| Uniprot Accession |
P0CAN6,P11911,P11912,P40293
Additional SwissProt Accessions: P11911,P40293,P0CAN6,P11912 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | B cell receptor signaling pathway |
| Gene Ensembl | ENSECAG00000007198, ENSMUSG00000003379, ENSBTAG00000001882, ENSCAFG00845001724, ENSMMUG00000047772, ENSG00000105369 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.