Human CGB5/HCG ORF/cDNA clone-Adenovirus particle (BC006290)

Cat. No.: vGMAP000482

Pre-made Human CGB5/HCG Adenovirus for CGB5 overexpression in-vitro and in-vivo. The CGB5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CGB5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CGB/hCG/hCG Beta/CGB3/CG-beta/CGB5/HCG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000482 Human CGB5 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000482
Gene Name CGB5
Accession Number BC006290
Gene ID 93659
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 498 bp
Gene Alias HCG
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGATGTTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGACATGGGCATCCAAGGAGCCGCTTCGGCCACGGTGCCGCCCCATCAATGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGCAGGGGGTCCTGCCGGCCCTGCCTCAGGTGGTGTGCAACTACCGCGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCGTGAACCCCGTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCCGCAGCACCACTGACTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGATGACCCCCGCTTCCAGGACTCCTCTTCCTCAAAGGCCCCTCCCCCCAGCCTTCCAAGTCCATCCCGACTCCCGGGGCCCTCGGACACCCCGATCCTCCCACAATAA
ORF Protein Sequence MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06575-Ab Anti-CGB3/ CG-beta/ CGB functional antibody
    Target Antigen GM-Tg-g-T06575-Ag CG-beta/CGB3 protein
    ORF Viral Vector pGMLP000518 Human CGB5 Lentivirus plasmid
    ORF Viral Vector pGMLP000845 Human CGB3 Lentivirus plasmid
    ORF Viral Vector pGMLP001861 Human CGB3 Lentivirus plasmid
    ORF Viral Vector pGMAP000226 Human CGB5 Adenovirus plasmid
    ORF Viral Vector pGMAP000262 Human CGB Adenovirus plasmid
    ORF Viral Vector pGMAP000482 Human CGB5 Adenovirus plasmid
    ORF Viral Vector vGMLP000518 Human CGB5 Lentivirus particle
    ORF Viral Vector vGMLP000845 Human CGB3 Lentivirus particle
    ORF Viral Vector vGMLP001861 Human CGB3 Lentivirus particle
    ORF Viral Vector vGMAP000226 Human CGB5 Adenovirus particle
    ORF Viral Vector vGMAP000262 Human CGB Adenovirus particle
    ORF Viral Vector vGMAP000482 Human CGB5 Adenovirus particle


    Target information

    Target ID GM-T06575
    Target Name CGB/hCG/hCG Beta/CGB3/CG-beta
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1082
    Gene ID
    Gene Symbols & Synonyms
    Target Alternative Names CGB, hCG, hCG Beta, CGB3, CG-beta,Choriogonadotropin subunit beta 3,Choriogonadotropin subunit beta (CG-beta), Chorionic gonadotropin chain beta,CGB,LHB,CGB5,CGB7,CGB8,hCGB
    Uniprot Accession
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.