Human CGB5/HCG ORF/cDNA clone-Adenovirus particle (BC006290)
Cat. No.: vGMAP000482
Pre-made Human CGB5/HCG Adenovirus for CGB5 overexpression in-vitro and in-vivo. The CGB5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CGB5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CGB/hCG/hCG Beta/CGB3/CG-beta/CGB5/HCG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP000482 | Human CGB5 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP000482 |
Gene Name | CGB5 |
Accession Number | BC006290 |
Gene ID | 93659 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 498 bp |
Gene Alias | HCG |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGATGTTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGACATGGGCATCCAAGGAGCCGCTTCGGCCACGGTGCCGCCCCATCAATGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGCAGGGGGTCCTGCCGGCCCTGCCTCAGGTGGTGTGCAACTACCGCGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCGTGAACCCCGTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCCGCAGCACCACTGACTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGATGACCCCCGCTTCCAGGACTCCTCTTCCTCAAAGGCCCCTCCCCCCAGCCTTCCAAGTCCATCCCGACTCCCGGGGCCCTCGGACACCCCGATCCTCCCACAATAA |
ORF Protein Sequence | MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T06575-Ab | Anti-CGB3/ CG-beta/ CGB functional antibody |
Target Antigen | GM-Tg-g-T06575-Ag | CG-beta/CGB3 protein |
ORF Viral Vector | pGMLP000518 | Human CGB5 Lentivirus plasmid |
ORF Viral Vector | pGMLP000845 | Human CGB3 Lentivirus plasmid |
ORF Viral Vector | pGMLP001861 | Human CGB3 Lentivirus plasmid |
ORF Viral Vector | pGMAP000226 | Human CGB5 Adenovirus plasmid |
ORF Viral Vector | pGMAP000262 | Human CGB Adenovirus plasmid |
ORF Viral Vector | pGMAP000482 | Human CGB5 Adenovirus plasmid |
ORF Viral Vector | vGMLP000518 | Human CGB5 Lentivirus particle |
ORF Viral Vector | vGMLP000845 | Human CGB3 Lentivirus particle |
ORF Viral Vector | vGMLP001861 | Human CGB3 Lentivirus particle |
ORF Viral Vector | vGMAP000226 | Human CGB5 Adenovirus particle |
ORF Viral Vector | vGMAP000262 | Human CGB Adenovirus particle |
ORF Viral Vector | vGMAP000482 | Human CGB5 Adenovirus particle |
Target information
Target ID | GM-T06575 |
Target Name | CGB/hCG/hCG Beta/CGB3/CG-beta |
Gene Group Identifier (Target Gene ID in Homo species) |
1082 |
Gene ID | |
Gene Symbols & Synonyms | |
Target Alternative Names | CG-beta,CGB,CGB3,CGB5,CGB7,CGB8,Choriogonadotropin subunit beta (CG-beta),Choriogonadotropin subunit beta 3,Chorionic gonadotropin chain beta,LHB,hCG,hCG Beta,hCGB |
Uniprot Accession | |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | |
Disease from KEGG | |
Gene Ensembl | |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.