Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human TIMP1/EPA/EPO ORF/cDNA clone-Adenovirus particle (BC000866)
Cat. No.: vGMAP000455
Pre-made Human TIMP1/EPA/EPO Adenovirus for TIMP1 overexpression in-vitro and in-vivo. The TIMP1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TIMP1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
TIMP1/EPA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000455 | Human TIMP1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000455 |
| Gene Name | TIMP1 |
| Accession Number | BC000866 |
| Gene ID | 7076 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 624 bp |
| Gene Alias | EPA,EPO,HCI |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCCCTTTGAGCCCCTGGCTTCTGGCATCCTGTTGTTGCTGTGGCTGATAGCCCCCAGCAGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTCGTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATACCAGCGTTATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAGGATGGACTCTTGCACATCACTACCTGCAGTTTCGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGCAAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAGGGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGGCAGTCCCTGCGGTCCCAGATAGCCTGA |
| ORF Protein Sequence | MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0506-Ab | Anti-TIMP1/ CLGI/ EPA functional antibody |
| Target Antigen | GM-Tg-g-SE0506-Ag | TIMP1 protein |
| ORF Viral Vector | pGMLP001347 | Human TIMP1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000257 | Human TIMP1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000455 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000469 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000553 | Human TIMP1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC001587 | Human TIMP1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP001347 | Human TIMP1 Lentivirus particle |
| ORF Viral Vector | vGMLV000257 | Human TIMP1 Lentivirus particle |
| ORF Viral Vector | vGMAP000455 | Human TIMP1 Adenovirus particle |
| ORF Viral Vector | vGMAP000469 | Human TIMP1 Adenovirus particle |
| ORF Viral Vector | vGMAP000553 | Human TIMP1 Adenovirus particle |
Target information
| Target ID | GM-SE0506 |
| Target Name | TIMP1 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
7076 |
| Gene ID |
100034220 (Equus caballus), 101095886 (Felis catus), 116510 (Rattus norvegicus), 21857 (Mus musculus) 282092 (Bos taurus), 403816 (Canis lupus familiaris), 574348 (Macaca mulatta), 7076 (Homo sapiens) |
| Gene Symbols & Synonyms | TIMP1,Timp1,TIMP-1,Timp,EPA,Clgi,TPA-S1,EPO,HCI,CLGI,TIMP |
| Target Alternative Names | CLGI,Clgi,EPA,EPO,Erythroid-potentiating activity (EPA),Fibroblast collagenase inhibitor (Collagenase inhibitor),HCI,Metalloproteinase inhibitor 1,TIMP,TIMP-1,TIMP1,TPA-S1,Timp,Timp1,Tissue inhibitor of metalloproteinases 1 (TIMP-1) |
| Uniprot Accession |
O02722,P01033,P12032,P20414,P30120,P81546,Q95KL9
Additional SwissProt Accessions: O02722,P30120,P12032,P20414,P81546,Q95KL9,P01033 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Diagnostics Biomarker |
| Disease | cancer, Dent disease, Vesicoureteral reflux |
| Disease from KEGG | HIF-1 signaling pathway |
| Gene Ensembl | ENSECAG00000014259, ENSMUSG00000001131, ENSBTAG00000066152, ENSCAFG00845030572, ENSMMUG00000011426, ENSG00000102265 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.