Human APOC3/APOCIII ORF/cDNA clone-Adenovirus particle (BC027977)

Cat. No.: vGMAP000448

Pre-made Human APOC3/APOCIII Adenovirus for APOC3 overexpression in-vitro and in-vivo. The APOC3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified APOC3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to APOC3/ApoCIII/APOC3/APOCIII products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000448 Human APOC3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000448
Gene Name APOC3
Accession Number BC027977
Gene ID 345
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 300 bp
Gene Alias APOCIII
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCTTCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGTTACATGAAGCACGCCACCAAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGGGGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAGTTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA
ORF Protein Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T31518-Ab Anti-APOC3/ ApoCIII/ APOCIII functional antibody
    Target Antigen GM-Tg-g-T31518-Ag ApoCIII/APOC3 protein
    ORF Viral Vector pGMLP000502 Human APOC3 Lentivirus plasmid
    ORF Viral Vector pGMAP000448 Human APOC3 Adenovirus plasmid
    ORF Viral Vector vGMLP000502 Human APOC3 Lentivirus particle
    ORF Viral Vector vGMAP000448 Human APOC3 Adenovirus particle


    Target information

    Target ID GM-T31518
    Target Name APOC3/ApoCIII
    Gene Group Identifier
    (Target Gene ID in Homo species)
    345
    Gene ID 101080822 (Felis catus), 111774219 (Equus caballus), 11814 (Mus musculus), 24207 (Rattus norvegicus)
    345 (Homo sapiens), 442970 (Canis lupus familiaris), 696726 (Macaca mulatta)
    Gene Symbols & Synonyms APOC3,Apoc3,Apo-CIII,ApoC-III,apo-CIII,apoC-III,Apo-C3,ApoC-3,APOCIII
    Target Alternative Names APOC3,APOCIII,Apo-C3,Apo-CIII,ApoC-3,ApoC-III,ApoCIII,Apoc3,Apolipoprotein C-III,Apolipoprotein C3,apo-CIII,apoC-III
    Uniprot Accession P02656,P06759,P0DN28,P12279,P33622
    Additional SwissProt Accessions: P0DN28,P33622,P06759,P02656,P12279
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease leukemia patients, Dent disease
    Disease from KEGG PPAR signaling pathway, Cholesterol metabolism
    Gene Ensembl ENSECAG00000039785, ENSMUSG00000032081, ENSG00000110245, ENSCAFG00845004284
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.