Human SERPINA1/A1A/A1AT ORF/cDNA clone-Adenovirus particle (BC011991)

Cat. No.: vGMAP000441

Pre-made Human SERPINA1/A1A/A1AT Adenovirus for SERPINA1 overexpression in-vitro and in-vivo. The SERPINA1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SERPINA1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1/SERPINA1/A1A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000441 Human SERPINA1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000441
Gene Name SERPINA1
Accession Number BC011991
Gene ID 5265
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1257 bp
Gene Alias A1A,A1AT,AAT,MGC23330,MGC9222,PI1,PRO2275
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATCACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAATGGCTTGTTCCTCAGCGAGGGCCTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTTCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACGTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAAATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAACTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCATTACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTAAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCCCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGACCAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAATAA
ORF Protein Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T28265-Ab Anti-A1AT/ SERPINA1/ A1A functional antibody
    Target Antigen GM-Tg-g-T28265-Ag SERPINA1 protein
    ORF Viral Vector pGMLP003894 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV001493 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV001572 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002164 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMAAV000168 Human SERPINA1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000441 Human SERPINA1 Adenovirus plasmid
    ORF Viral Vector vGMLP003894 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV001493 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV001572 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV002164 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMAAV000168 Human SERPINA1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000441 Human SERPINA1 Adenovirus particle


    Target information

    Target ID GM-T28265
    Target Name Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5265
    Gene ID 24648 (Rattus norvegicus), 280699 (Bos taurus), 480422 (Canis lupus familiaris), 5265 (Homo sapiens)
    701361 (Macaca mulatta)
    Gene Symbols & Synonyms Serpina1,SERPINA1,Pi,AAT,Spi1,PI,A1A,PI1,A1AT,nNIF,PRO2275,alpha1AT
    Target Alternative Names A1A,A1AT,AAT,Alpha 1 Antitrypsin,Alpha-1 protease inhibitor,Alpha-1-antiproteinase,Alpha-1-antitrypsin,PI,PI1,PRO2275,Pi,SERPINA1,Serpin A1,Serpina1,Spi1,alpha1AT,nNIF
    Uniprot Accession P01009,P17475,P34955
    Additional SwissProt Accessions: P17475,P34955,P01009
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Malignant neoplasm of bladder, IgA glomerulonephritis, Nephrotic syndrome with focal and segmental glomerular lesions, Diabetic Nephropathy, Contrast - Induced Nephropathy, Congenital occlusion of ureteropelvic junction, Calculus of kidney, Nephrotic syndrome, Acute pancreatitis, Juvenile arthritis, Urinary bladder urothelial carcinoma, Type 2 diabetes mellitus with diabetic nephropathy, protease
    Disease from KEGG Complement and coagulation cascades
    Gene Ensembl ENSBTAG00000018843, ENSCAFG00845002999, ENSG00000197249, ENSMMUG00000020426
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.