Human LALBA ORF/cDNA clone-Adenovirus particle (BC112316)

Cat. No.: vGMAP000430

Pre-made Human LALBA/ Adenovirus for LALBA overexpression in-vitro and in-vivo. The LALBA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified LALBA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to LALBA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000430 Human LALBA Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000430
Gene Name LALBA
Accession Number BC112316
Gene ID 3906
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 429 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGTTCTTTGTCCCTCTGTTCCTGGTGGGCATCCTGTTCCCTGCCATCCTGGCCAAGCAATTCACAAAATGTGAGCTGTCCCAGCTGCTGAAAGACATAGATGGTTATGGAGGCATCGCTTTGCCTGAATTGATCTGTACCATGTTTCACACCAGTGGTTATGACACACAAGCCATAGTTGAAAACAATGAAAGCACGGAATATGGACTCTTCCAGATCAGTAATAAGCTTTGGTGCAAGAGCAGCCAGGTCCCTCAGTCAAGGAACATCTGTGACATCTCCTGTGACAAGTTCCTGGATGATGACATTACTGATGACATAATGTGTGCCAAGAAGATCCTGGATATTAAAGGAATTGACTACTGGTTGGCCCATAAAGCCCTCTGCACTGAGAAGCTGGAACAGTGGCTTTGTGAGAAGTTGTGA
ORF Protein Sequence MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T12938-Ab Anti-LALBA/ LYZG functional antibody
    Target Antigen GM-Tg-g-T12938-Ag LALBA protein
    ORF Viral Vector pGMAP000430 Human LALBA Adenovirus plasmid
    ORF Viral Vector vGMAP000430 Human LALBA Adenovirus particle


    Target information

    Target ID GM-T12938
    Target Name LALBA
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3906
    Gene ID 100146585 (Equus caballus), 101090027 (Felis catus), 16770 (Mus musculus), 24528 (Rattus norvegicus)
    281894 (Bos taurus), 3906 (Homo sapiens), 403730 (Canis lupus familiaris), 707442 (Macaca mulatta)
    Gene Symbols & Synonyms LALBA,Lalba,LYZG,Lyzg,alfaLA,a-LACTA,HAMLET
    Target Alternative Names Alpha-lactalbumin,HAMLET,LALBA,LYZG,Lactose synthase B protein,Lalba,Lysozyme-like protein 7,Lyzg,a-LACTA,alfaLA
    Uniprot Accession P00709,P00711,P00714,P29752,P37154,Q9N2G9
    Additional SwissProt Accessions: P37154,P29752,P00714,P00711,P00709,Q9N2G9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease breast cancer
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSECAG00000001401, ENSMUSG00000022991, ENSBTAG00000005859, ENSG00000167531, ENSCAFG00845025453, ENSMMUG00000000283
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.