Human NTS/NMN-125/NN ORF/cDNA clone-Adenovirus particle (BC010918)

Cat. No.: vGMAP000426

Pre-made Human NTS/NMN-125/NN Adenovirus for NTS overexpression in-vitro and in-vivo. The NTS adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified NTS-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to NTS/NMN-125 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000426 Human NTS Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000426
Gene Name NTS
Accession Number BC010918
Gene ID 4922
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 513 bp
Gene Alias NMN-125,NN,NT,NT/N,NTS1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGATGGCAGGAATGAAAATCCAGCTTGTATGCATGCTACTCCTGGCTTTCAGCTCCTGGAGTCTGTGCTCAGATTCAGAAGAGGAAATGAAAGCATTAGAAGCAGATTTCTTGACCAATATGCATACATCAAAGATTAGTAAAGCACATGTTCCCTCTTGGAAGATGACTCTGCTAAATGTTTGCAGTCTTGTAAATAATTTGAACAGCCCAGCTGAGGAAACAGGAGAAGTTCATGAAGAGGAGCTTGTTGCAAGAAGGAAACTTCCTACTGCTTTAGATGGCTTTAGCTTGGAAGCAATGTTGACAATATACCAGCTCCACAAAATCTGTCACAGCAGGGCTTTTCAACACTGGGAGTTAATCCAGGAAGATATTCTTGATACTGGAAATGACAAAAATGGAAAGGAAGAAGTCATAAAGAGAAAAATTCCTTATATTCTGAAACGGCAGCTGTATGAGAATAAACCCAGAAGACCCTACATACTCAAAAGAGATTCTTACTATTACTGA
ORF Protein Sequence MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1140-Ab Anti-NEUT/ NTS/ NMN-125 functional antibody
    Target Antigen GM-Tg-g-SE1140-Ag NTS protein
    ORF Viral Vector pGMLP000544 Human NTS Lentivirus plasmid
    ORF Viral Vector pGMAP000426 Human NTS Adenovirus plasmid
    ORF Viral Vector vGMLP000544 Human NTS Lentivirus particle
    ORF Viral Vector vGMAP000426 Human NTS Adenovirus particle


    Target information

    Target ID GM-SE1140
    Target Name NTS
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4922
    Gene ID 100062225 (Equus caballus), 101095835 (Felis catus), 280881 (Bos taurus), 299757 (Rattus norvegicus)
    4922 (Homo sapiens), 611687 (Canis lupus familiaris), 67405 (Mus musculus), 700189 (Macaca mulatta)
    Gene Symbols & Synonyms NTS,Nts,NN,NT,NT/N,NTS1,NMN-125,5033428E16Rik
    Target Alternative Names NTS,Neurotensin/neuromedin N,NN,NT,NT/N,NTS1,NMN-125
    Uniprot Accession P01156,P10673,P20068,P30990,Q9D3P9
    Additional SwissProt Accessions: P01156,P20068,P30990,P10673,Q9D3P9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000010879, ENSBTAG00000005305, ENSG00000133636, ENSCAFG00845012392, ENSMUSG00000019890, ENSMMUG00000023155
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.