Human B2M ORF/cDNA clone-Adenovirus particle (BC032589)
Cat. No.: vGMAP000411
Pre-made Human B2M/ Adenovirus for B2M overexpression in-vitro and in-vivo. The B2M adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified B2M-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
B2M/Beta-2-Microglobulin/B2M products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000411 | Human B2M Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000411 |
| Gene Name | B2M |
| Accession Number | BC032589 |
| Gene ID | 567 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 360 bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA |
| ORF Protein Sequence | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T58080-Ab | Anti-B2MG/ B2M/ IMD43 monoclonal antibody |
| Target Antigen | GM-Tg-g-T58080-Ag | B2M VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000539 | Human B2M Lentivirus plasmid |
| ORF Viral Vector | pGMLV002489 | Human B2M Lentivirus plasmid |
| ORF Viral Vector | pGMAP000411 | Human B2M Adenovirus plasmid |
| ORF Viral Vector | vGMLP000539 | Human B2M Lentivirus particle |
| ORF Viral Vector | vGMLV002489 | Human B2M Lentivirus particle |
| ORF Viral Vector | vGMAP000411 | Human B2M Adenovirus particle |
Target information
| Target ID | GM-T58080 |
| Target Name | B2M/Beta-2-Microglobulin |
|
Gene Group Identifier (Target Gene ID in Homo species) |
567 |
| Gene ID |
100034203 (Equus caballus), 100855741 (Canis lupus familiaris), 12010 (Mus musculus), 24223 (Rattus norvegicus) 494145 (Felis catus), 567 (Homo sapiens), 712428 (Macaca mulatta) |
| Gene Symbols & Synonyms | B2M,B2m,Ly-m11,beta2m,beta2-m,IMD43,AMYLD6,MHC1D4 |
| Target Alternative Names | AMYLD6,B2M,B2m,Beta-2-Microglobulin,Beta-2-microglobulin,IMD43,Ly-m11,MHC1D4,beta2-m,beta2m |
| Uniprot Accession |
P01887,P07151,P19341,P30441,P61769,Q5MGS7,Q6V7J5
Additional SwissProt Accessions: P30441,P19341,P01887,P07151,Q5MGS7,P61769,Q6V7J5 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Ovary Cancer, Urinary tract obstruction, Malignant neoplasm of prostate, Congenital occlusion of ureteropelvic junction, Acute kidney failure, Asphyxia neonatorum, Autosomal Dominant Polycystic Kidney Disease, Balkan nephropathy, Bronchopulmonary Dysplasia, Dent disease, Kidney transplant rejection, lymphomas, Malignant neoplasm of colon, Nephropathy induced by other drugs, medicaments and biological substances, Nephrotic syndrome, Proteinuria, Renal fibrosis, Peripheral T-cell lymphomas (PTCL) |
| Disease from KEGG | Antigen processing and presentation, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection |
| Gene Ensembl | ENSMUSG00000060802, ENSG00000166710, ENSMMUG00000060797 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


