Human MFAP4 ORF/cDNA clone-Adenovirus particle (BC062415)

Cat. No.: vGMAP000403

Pre-made Human MFAP4/ Adenovirus for MFAP4 overexpression in-vitro and in-vivo. The MFAP4 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified MFAP4-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to MFAP4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000403 Human MFAP4 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000403
Gene Name MFAP4
Accession Number BC062415
Gene ID 4239
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 768 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGCACTCCTGGCCCTGCCGCTGCTGCTGCTTCTCTCCACGCCCCCGTGTGCCCCCCAGGTCTCCGGGATCCGAGGAGATGCTCTGGAGAGGTTTTGCCTTCAGCAACCCCTGGACTGTGACGACATCTATGCCCAGGGCTACCAGTCAGACGGCGTGTACCTCATCTACCCCTCGGGCCCCAGTGTGCCTGTGCCCGTCTTCTGTGACATGACCACCGAGGGCGGGAAGTGGACGGTTTTCCAGAAGAGATTCAATGGCTCAGTAAGTTTCTTCCGCGGCTGGAATGACTACAAGCTGGGCTTCGGCCGTGCTGATGGAGAGTACTGGCTGGGGCTGCAGAACATGCACCTCCTGACACTGAAGCAGAAGTATGAGCTGCGAGTGGACTTGGAGGACTTTGAGAACAACACGGCCTATGCCAAGTACGCTGACTTCTCCATCTCCCCGAACGCGGTCAGCGCAGAGGAGGATGGCTACACCCTCTTTGTGGCAGGCTTTGAGGATGGCGGGGTAGGTGACTCCCTGTCCTACCACAGTGGCCAGAAGTTCTCTACCTTCGACCGGGACCAGGACCTCTTTGTGCAGAACTGCGCAGCTCTCTCCTCAGGAGCCTTCTGGTTCCGCAGCTGCCACTTTGCCAACCTCAATGGCTTCTACCTAGGTGGCTCCCACCTCTCTTATGCCAATGGCATCAACTGGGCCCAGTGGAAGGGCTTCTACTACTCCCTCAAACGCACTGAGATGAAAATCCGCCGGGCCTGA
ORF Protein Sequence MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0341-Ab Anti-MFAP4 functional antibody
    Target Antigen GM-Tg-g-SE0341-Ag MFAP4 protein
    ORF Viral Vector pGMAP000403 Human MFAP4 Adenovirus plasmid
    ORF Viral Vector vGMAP000403 Human MFAP4 Adenovirus particle


    Target information

    Target ID GM-SE0341
    Target Name MFAP4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4239
    Gene ID 100073173 (Equus caballus), 101085505 (Felis catus), 286766 (Bos taurus), 287382 (Rattus norvegicus)
    4239 (Homo sapiens), 489531 (Canis lupus familiaris), 710893 (Macaca mulatta), 76293 (Mus musculus)
    Gene Symbols & Synonyms MFAP4,Mfap4,Magp-36,1110007F23Rik
    Target Alternative Names MFAP4,Microfibril-associated glycoprotein 4
    Uniprot Accession P55083,P55918,Q9D1H9
    Additional SwissProt Accessions: P55918,P55083,Q9D1H9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000013301, ENSBTAG00000006187, ENSG00000166482, ENSCAFG00845018581, ENSMMUG00000008538, ENSMUSG00000042436
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.