Human PPP1CA/MGC15877/MGC1674 ORF/cDNA clone-Adenovirus particle (BC001888)
Cat. No.: vGMAP000389
Pre-made Human PPP1CA/MGC15877/MGC1674 Adenovirus for PPP1CA overexpression in-vitro and in-vivo. The PPP1CA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PPP1CA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
PPP1CA/MGC15877 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000389 | Human PPP1CA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000389 |
| Gene Name | PPP1CA |
| Accession Number | BC001888 |
| Gene ID | 5499 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 993 bp |
| Gene Alias | MGC15877,MGC1674,PP-1A |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCGACAGCGAGAAGCTCAACCTGGACTCGATCATCGGGCGCCTGCTGGAAGTGCAGGGCTCGCGGCCTGGCAAGAATGTACAGCTGACAGAGAACGAGATCCGCGGTCTGTGCCTGAAATCCCGGGAGATTTTTCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAGATCTGCGGTGACATACACGGCCAGTACTACGACCTTCTGCGACTATTTGAGTATGGCGGTTTCCCTCCCGAGAGCAACTACCTCTTTCTGGGGGACTATGTGGACAGGGGCAAGCAGTCCTTGGAGACCATCTGCCTGCTGCTGGCCTATAAGATCAAGTACCCCGAGAACTTCTTCCTGCTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTATGGTTTCTACGATGAGTGCAAGAGACGCTACAACATCAAACTGTGGAAAACCTTCACTGACTGCTTCAACTGCCTGCCCATCGCGGCCATAGTGGACGAAAAGATCTTCTGCTGCCACGGAGGCCTGTCCCCGGACCTGCAGTCTATGGAGCAGATTCGGCGGATCATGCGGCCCACAGATGTGCCTGACCAGGGCCTGCTGTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGCGAGAACGACCGTGGCGTCTCTTTTACCTTTGGAGCCGAGGTGGTGGCCAAGTTCCTCCACAAGCACGACTTGGACCTCATCTGCCGAGCACACCAGGTGGTAGAAGACGGCTACGAGTTCTTTGCCAAGCGGCAGCTGGTGACACTTTTCTCAGCTCCCAACTACTGTGGCGAGTTTGACAATGCTGGCGCCATGATGAGTGTGGACGAGACCCTCATGTGCTCTTTCCAGATCCTCAAGCCCGCCGACAAGAACAAGGGGAAGTACGGGCAGTTCAGTGGCCTGAACCCTGGAGGCCGACCCATCACCCCACCCCGCAATTCCGCCAAAGCCAAGAAATAG |
| ORF Protein Sequence | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T59845-Ab | Anti-PP1A/ PPP1CA/ PP-1A monoclonal antibody |
| Target Antigen | GM-Tg-g-T59845-Ag | PPP1CA VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000473 | Human PPP1CA Lentivirus plasmid |
| ORF Viral Vector | pGMLP005601 | Human PPP1CA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000389 | Human PPP1CA Adenovirus plasmid |
| ORF Viral Vector | pGMPC000448 | Human PPP1CA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000473 | Human PPP1CA Lentivirus particle |
| ORF Viral Vector | vGMLP005601 | Human PPP1CA Lentivirus particle |
| ORF Viral Vector | vGMAP000389 | Human PPP1CA Adenovirus particle |
Target information
| Target ID | GM-T59845 |
| Target Name | PPP1CA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5499 |
| Gene ID |
100059233 (Equus caballus), 109492306 (Felis catus), 19045 (Mus musculus), 24668 (Rattus norvegicus) 403609 (Canis lupus familiaris), 516175 (Bos taurus), 5499 (Homo sapiens), 721735 (Macaca mulatta) |
| Gene Symbols & Synonyms | PPP1CA,Ppp1ca,Ppp1c,dism2,PP1alpha,PP1A,PP-1A,PPP1A |
| Target Alternative Names | PP-1A,PP1A,PP1alpha,PPP1A,PPP1CA,Ppp1c,Ppp1ca,Serine/threonine-protein phosphatase PP1-alpha catalytic subunit,dism2 |
| Uniprot Accession |
P62136,P62137,P62138,Q3T0E7,Q8WMS6
Additional SwissProt Accessions: P62137,P62138,Q8WMS6,Q3T0E7,P62136 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | cGMP-PKG signaling pathway, cAMP signaling pathway, Cellular senescence, Adrenergic signaling in cardiomyocytes, Vascular smooth muscle contraction, Hippo signaling pathway, Focal adhesion, Platelet activation, Long-term potentiation, Inflammatory mediator regulation of TRP channels, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Insulin resistance, Amphetamine addiction, Proteoglycans in cancer |
| Gene Ensembl | ENSECAG00000010532, ENSMUSG00000040385, ENSCAFG00845010538, ENSBTAG00000012146, ENSG00000172531, ENSMMUG00000017278 |
| Target Classification | Kinase |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


