Human NPY/PYY4 ORF/cDNA clone-Adenovirus particle (BC029497)

Cat. No.: vGMAP000379

Pre-made Human NPY/PYY4 Adenovirus for NPY overexpression in-vitro and in-vivo. The NPY adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified NPY-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Neuropeptide Y/NPY/NPY/PYY4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000379 Human NPY Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000379
Gene Name NPY
Accession Number BC029497
Gene ID 4852
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 294 bp
Gene Alias PYY4
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTGTGCCTGGGTGCGCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCACCAGCGGAGGACATGGCCAGATACTACTCAGCGCTGCGACACTACATCAACCTCATCACCAGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGAGAAAGCACAGAAAATGTTCCCAGAACTCGGCTTGAAGACCCTGCAATGTGGTGA
ORF Protein Sequence MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T51671-Ab Anti-NPY/ PYY4 functional antibody
    Target Antigen GM-Tg-g-T51671-Ag NPY protein
    ORF Viral Vector pGMAP000379 Human NPY Adenovirus plasmid
    ORF Viral Vector vGMAP000379 Human NPY Adenovirus particle


    Target information

    Target ID GM-T51671
    Target Name Neuropeptide Y/NPY
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4852
    Gene ID 100053806 (Equus caballus), 101096968 (Felis catus), 109648 (Mus musculus), 24604 (Rattus norvegicus)
    475257 (Canis lupus familiaris), 4852 (Homo sapiens), 504216 (Bos taurus), 574114 (Macaca mulatta)
    Gene Symbols & Synonyms NPY,Npy,0710005A05Rik,NPY02,RATNPY,RATNPY02,PYY4
    Target Alternative Names 0710005A05Rik,NPY,NPY02,Neuropeptide Y,Npy,PYY4,Pro-neuropeptide Y,RATNPY,RATNPY02
    Uniprot Accession P01303,P07808,P57774,Q6RUW3,Q9XSW6
    Additional SwissProt Accessions: P57774,P07808,P01303,Q6RUW3,Q9XSW6
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG cAMP signaling pathway, Neuroactive ligand-receptor interaction, Adipocytokine signaling pathway, Regulation of lipolysis in adipocytes
    Gene Ensembl ENSMUSG00000029819, ENSCAFG00845010065, ENSG00000122585, ENSBTAG00000004503, ENSMMUG00000009818
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.