Human SUMO1/GMP1/PIC1 ORF/cDNA clone-Adenovirus particle (BC006462)

Cat. No.: vGMAP000313

Pre-made Human SUMO1/GMP1/PIC1 Adenovirus for SUMO1 overexpression in-vitro and in-vivo. The SUMO1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SUMO1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to SUMO1/GMP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000313 Human SUMO1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000313
Gene Name SUMO1
Accession Number BC006462
Gene ID 7341
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 306 bp
Gene Alias GMP1,PIC1,SENP2,SMT3,SMT3C,SMT3H3,SUMO-1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG
ORF Protein Sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA023-Ab Anti-SUMO1 monoclonal antibody
    Target Antigen GM-Tg-g-TA023-Ag SUMO1 protein
    ORF Viral Vector pGMLP000463 Human SUMO1 Lentivirus plasmid
    ORF Viral Vector pGMAP000313 Human SUMO1 Adenovirus plasmid
    ORF Viral Vector pGMPC000059 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001223 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001826 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001862 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000463 Human SUMO1 Lentivirus particle
    ORF Viral Vector vGMAP000313 Human SUMO1 Adenovirus particle


    Target information

    Target ID GM-TA023
    Target Name SUMO1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7341
    Gene ID 100067107 (Equus caballus), 101095673 (Felis catus), 22218 (Mus musculus), 301442 (Rattus norvegicus)
    478874 (Canis lupus familiaris), 614967 (Bos taurus), 703644 (Macaca mulatta), 7341 (Homo sapiens)
    Gene Symbols & Synonyms SUMO1,Sumo1,GMP1,PIC1,SMT3,Ubl1,SMTP3,Smt3C,SMT3H3,SUMO-1,SENTRIN,DAP1,UBL1,OFC10,SENP2,SMT3C
    Target Alternative Names DAP1,GAP-modifying protein 1 (GMP1),GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3 homolog 3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,Sentrin,Small ubiquitin-related modifier 1,Smt3C,Sumo1,UBL1,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C (Smt3C),Ubiquitin-like protein UBL1,Ubl1
    Uniprot Accession P63165,P63166,Q5E9D1,Q5I0H3
    Additional SwissProt Accessions: P63166,Q5I0H3,Q5E9D1,P63165
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Fluid shear stress and atherosclerosis
    Gene Ensembl ENSMUSG00000026021, ENSMMUG00000005240, ENSG00000116030
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.