Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human S100A8/60B8AG/CGLA ORF/cDNA clone-Adenovirus particle (BC005928)
Cat. No.: vGMAP000312
Pre-made Human S100A8/60B8AG/CGLA Adenovirus for S100A8 overexpression in-vitro and in-vivo. The S100A8 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified S100A8-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
S100A8/60B8AG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000312 | Human S100A8 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000312 |
| Gene Name | S100A8 |
| Accession Number | BC005928 |
| Gene ID | 6279 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 282 bp |
| Gene Alias | 60B8AG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTTGACCGAGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGGGGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATCAGGAAAAAGGGTGCAGACGTCTGGTTCAAAGAGTTGGATATCAACACTGATGGTGCAGTTAACTTCCAGGAGTTCCTCATTCTGGTGATAAAGATGGGCGTGGCAGCCCACAAAAAAAGCCATGAAGAAAGCCACAAAGAGTAG |
| ORF Protein Sequence | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T27402-Ab | Anti-S10A8/ S100A8/ 60B8AG monoclonal antibody |
| Target Antigen | GM-Tg-g-T27402-Ag | S100A8 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000464 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000491 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000751 | Human S100A8 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000312 | Human S100A8 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000464 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMLV000491 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMLV000751 | Human S100A8 Lentivirus particle |
| ORF Viral Vector | vGMAP000312 | Human S100A8 Adenovirus particle |
Target information
| Target ID | GM-T27402 |
| Target Name | S100A8 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6279 |
| Gene ID |
100061766 (Equus caballus), 101084164 (Felis catus), 116547 (Rattus norvegicus), 20201 (Mus musculus) 490461 (Canis lupus familiaris), 616818 (Bos taurus), 6279 (Homo sapiens), 714740 (Macaca mulatta) |
| Gene Symbols & Synonyms | S100A8,S100a8,Mrp8,p8,B8Ag,CFAg,Caga,MRP8,CP-10,60B8Ag,P8,MIF,NIF,CAGA,CFAG,CGLA,L1Ag,MA387,60B8AG,S100-A8 |
| Target Alternative Names | 60B8AG,60B8Ag,B8Ag,CAGA,CFAG,CFAg,CGLA,CP-10,Caga,Calgranulin-A,Calprotectin L1L subunit,Cystic fibrosis antigen (CFAG),L1Ag,Leukocyte L1 complex light chain,MA387,MIF,MRP8,Migration inhibitory factor-related protein 8 (MRP-8,Mrp8,NIF,P8,Protein S100-A8,S100 calcium-binding protein A8,S100-A8,S100A8,S100a8,Urinary stone protein band A,p8,p8) |
| Uniprot Accession |
P05109,P27005,P28782,P50115
Additional SwissProt Accessions: P50115,P27005,P28782,P05109 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Acute appendicitis, Congenital occlusion of ureteropelvic junction, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Malignant neoplasm of bladder |
| Disease from KEGG | IL-17 signaling pathway |
| Gene Ensembl | ENSMUSG00000056054, ENSCAFG00845002217, ENSG00000143546, ENSMMUG00000044778 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.