Human TNF/DIF/TNF-alpha ORF/cDNA clone-Adenovirus particle (BC028148)

Cat. No.: vGMAP000307

Pre-made Human TNF/DIF/TNF-alpha Adenovirus for TNF overexpression in-vitro and in-vivo. The TNF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TNF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TNF-alpha/TNF/TNF/DIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000307 Human TNF Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000307
Gene Name TNF
Accession Number BC028148
Gene ID 7124
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 702 bp
Gene Alias DIF,TNF-alpha,TNFSF2
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAAGAAGACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCAGCCTCTTCTCCTTCCTGATCGTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCCCCCAGAGGGAAGAGTTCCCCAGGGACCTCTCTCTAATCAGCCCTCTGGCCCAGGCAGTCAGATCATCTTCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTCAAGCTGAGGGGCAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATGGCGTGGAGCTGAGAGATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCATCTACTCCCAGGTCCTCTTCAAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGTCAACCTCCTCTCTGCCATCAAGAGCCCCTGCCAGAGGGAGACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCCCATCTATCTGGGAGGGGTCTTCCAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATCAATCGGCCCGACTATCTCGACTTTGCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGCCCTGTGA
ORF Protein Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-478 Pre-Made Remtolumab biosimilar, Bispecific Dual Variable Domain IG: Anti-IL17A/IL17;TNFA/TNF therapeutic antibody
    Biosimilar GMP-Bios-INN-846 Pre-Made Etanercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-ab-445 Pre-Made Placulumab biosimilar, Single Domain Variable Fragment (VL + Fc), Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-249 Pre-Made Golimumab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-887 Pre-Made Lenercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-INN-935 Pre-Made Onercept Biosimilar, Recombinant Protein targeting TNF: Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-INN-927 Pre-Made Nerelimomab Biosimilar, Whole Mab, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-721 Pre-Made Afelimomab Biosimilar, Fab Fusion, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-310 Pre-Made Licaminlimab biosimilar, scFv, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-009 Pre-Made Adalimumab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-718 Pre-Made Adalimumab Beta Biosimilar, Whole Mab, Anti-Tnf Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-1036 Pre-Made Tulinercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Biosimilar GMP-Bios-ab-274 Pre-Made Infliximab biosimilar, Whole mAb, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-ab-419 Pre-Made Ozoralizumab biosimilar, Bispecific Single Domains (VH-VH'-VH), Anti-TNFA/TNF;ALB Antibody: Anti-DIF/TNF-alpha/TNFSF2/TNLG1F;FDAHT/HSA/PRO0883/PRO0903/PRO1341 therapeutic antibody
    Biosimilar GMP-Bios-ab-100 Pre-Made Certolizumab biosimilar, Fab, Anti-TNFA/TNF Antibody: Anti-DIF/TNFSF2/TNLG1F therapeutic antibody
    Biosimilar GMP-Bios-INN-938 Pre-Made Opinercept Biosimilar, Fusion Protein targeting TNF fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting DIF/TNFSF2/TNLG1F
    Target Antibody GM-Tg-g-T20178-Ab Anti-TNFA/ TNF/ DIF-alpha monoclonal antibody
    Target Antigen GM-Tg-g-T20178-Ag TNF VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T20178 Tumor necrosis factor (TNF) protein & antibody
    ORF Viral Vector pGMAD000017 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMAD000416 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMAP000307 Human TNF Adenovirus plasmid
    ORF Viral Vector pGMPC004774 Human TNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAD000017 Human TNF Adenovirus particle
    ORF Viral Vector vGMAD000416 Human TNF Adenovirus particle
    ORF Viral Vector vGMAP000307 Human TNF Adenovirus particle


    Target information

    Target ID GM-T20178
    Target Name TNF-alpha/TNF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7124
    Gene ID 100033834 (Equus caballus), 21926 (Mus musculus), 24835 (Rattus norvegicus), 280943 (Bos taurus)
    403922 (Canis lupus familiaris), 493755 (Felis catus), 7124 (Homo sapiens), 715467 (Macaca mulatta)
    Gene Symbols & Synonyms TNF,Tnf,TNFA,TNF-a,TNFSF2,TNLG1F,TNF-alpha,DIF,Tnfa,Tnlg1f,Tnfsf1a,TNFalpha,RATTNF,TNFa,cTNF,IMD127,TNF-ALPHA
    Target Alternative Names TNF-alpha, TNF,Tumor necrosis factor,Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2 (TNF-a),DIF,TNFA,IMD127,TNFSF2,TNLG1F,TNF-alpha
    Uniprot Accession P01375,P06804,P16599,P19101,P29553,P48094,P51742,Q06599
    Additional SwissProt Accessions: P29553,P06804,P16599,Q06599,P51742,P19101,P01375,P48094
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer, Ovary Cancer, toluene diisocyanate asthma, Giant Cell Arteritis, Polymyalgia Rheumatica, Chronic Kidney Disease, Dent disease, Hodgkin's disease, Kidney transplant rejection, pancreatic cancer, Chronic Glomerulonephritis, Asthma
    Disease from KEGG Antifolate resistance, MAPK signaling pathway, Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, NF-kappa B signaling pathway, Sphingolipid signaling pathway, Apoptosis, TGF-beta signaling pathway, Osteoclast differentiation, Antigen processing and presentation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, Hematopoietic cell lineage, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Adipocytokine signaling pathway, Type II diabetes mellitus, Insulin resistance, AGE-RAGE signaling pathway in diabetic complications, Alcoholic liver disease, Type I diabetes mellitus, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Legionellosis, Yersinia infection, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, Proteoglycans in cancer, Asthma, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Hypertrophic cardiomyopathy, Dilated cardiomyopathy, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000001174, ENSMUSG00000024401, ENSCAFG00845010558, ENSG00000232810, ENSMMUG00000045654
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.