Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CD3D/CD3-DELTA ORF/cDNA clone-Adenovirus particle (BC070321)
Cat. No.: vGMAP000294
Pre-made Human CD3D/CD3-DELTA Adenovirus for CD3D overexpression in-vitro and in-vivo. The CD3D adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CD3D-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CD3 Delta/CD3D/CD3d/CD3D/CD3-DELTA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000294 | Human CD3D Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000294 |
| Gene Name | CD3D |
| Accession Number | BC070321 |
| Gene ID | 915 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 516 bp |
| Gene Alias | CD3-DELTA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAACATAGCACGTTTCTCTCTGGCCTGGTACTGGCTACCCTTCTCTCGCAAGTGAGCCCCTTCAAGATACCTATAGAGGAACTTGAGGACAGAGTGTTTGTGAATTGCAATACCAGCATCACATGGGTAGAGGGAACGGTGGGAACACTGCTCTCAGACATTACAAGACTGGACCTGGGAAAACGCATCCTGGACCCACGAGGAATATATAGGTGTAATGGGACAGATATATACAAGGACAAAGAATCTACCGTGCAAGTTCATTATCGAATGTGCCAGAGCTGTGTGGAGCTGGATCCAGCCACCGTGGCTGGCATCATTGTCACTGATGTCATTGCCACTCTGCTCCTTGCTTTGGGAGTCTTCTGCTTTGCTGGACATGAGACTGGAAGGCTGTCTGGGGCTGCCGACACACAAGCTCTGTTGAGGAATGACCAGGTCTATCAGCCCCTCCGAGATCGAGATGATGCTCAGTACAGCCACCTTGGAGGAAACTGGGCTCGGAACAAGTGA |
| ORF Protein Sequence | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0211-Ab | Anti-CD3D/ CD3-DELTA/ IMD19 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0211-Ag | CD3D VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000460 | Human CD3D Lentivirus plasmid |
| ORF Viral Vector | pGMAP000294 | Human CD3D Adenovirus plasmid |
| ORF Viral Vector | pGMPC001048 | Human CD3D Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000460 | Human CD3D Lentivirus particle |
| ORF Viral Vector | vGMAP000294 | Human CD3D Adenovirus particle |
Target information
| Target ID | GM-MP0211 |
| Target Name | CD3 Delta/CD3D/CD3d |
|
Gene Group Identifier （Target Gene ID in Homo species) |
915 |
| Gene ID |
100062931 (Equus caballus), 101083107 (Felis catus), 12500 (Mus musculus), 25710 (Rattus norvegicus) 281053 (Bos taurus), 479419 (Canis lupus familiaris), 699582 (Macaca mulatta), 915 (Homo sapiens) |
| Gene Symbols & Synonyms | CD3D,Cd3d,T3d,T3D,IMD19,CD3DELTA,CD3-DELTA |
| Target Alternative Names | CD3 Delta,CD3-DELTA,CD3D,CD3DELTA,CD3d,Cd3d,IMD19,T-cell receptor T3 delta chain,T-cell surface glycoprotein CD3 delta chain,T3D,T3d |
| Uniprot Accession |
P04234,P04235,P19377,Q28072
Additional SwissProt Accessions: P04235,P19377,Q28072,P04234 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Measles, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer |
| Gene Ensembl | ENSECAG00000018190, ENSMUSG00000032094, ENSBTAG00000006452, ENSCAFG00845002450, ENSMMUG00000049268, ENSG00000167286 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.