Human CDK6/MGC59692/PLSTIRE ORF/cDNA clone-Adenovirus particle (BC052264)

Cat. No.: vGMAP000280

Pre-made Human CDK6/MGC59692/PLSTIRE Adenovirus for CDK6 overexpression in-vitro and in-vivo. The CDK6 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CDK6-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CDK6/MGC59692 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000280 Human CDK6 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000280
Gene Name CDK6
Accession Number BC052264
Gene ID 1021
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 981 bp
Gene Alias MGC59692,PLSTIRE
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGAAGGACGGCCTGTGCCGCGCTGACCAGCAGTACGAATGCGTGGCGGAGATCGGGGAGGGCGCCTATGGGAAGGTGTTCAAGGCCCGCGACTTGAAGAACGGAGGCCGTTTCGTGGCGTTGAAGCGCGTGCGGGTGCAGACCGGCGAGGAGGGCATGCCGCTCTCCACCATCCGCGAGGTGGCGGTGCTGAGGCACCTGGAGACCTTCGAGCACCCCAACGTGGTCAGGTTGTTTGATGTGTGCACAGTGTCACGAACAGACAGAGAAACCAAACTAACTTTAGTGTTTGAACATGTCGATCAAGACTTGACCACTTACTTGGATAAAGTTCCAGAGCCTGGAGTGCCCACTGAAACCATAAAGGATATGATGTTTCAGCTTCTCCGAGGTCTGGACTTTCTTCATTCACACCGAGTAGTGCATCGCGATCTAAAACCACAGAACATTCTGGTGACCAGCAGCGGACAAATAAAACTCGCTGACTTCGGCCTTGCCCGCATCTATAGTTTCCAGATGGCTCTAACCTCAGTGGTCGTCACGCTGTGGTACAGAGCACCCGAAGTCTTGCTCCAGTCCAGCTACGCCACCCCCGTGGATCTCTGGAGTGTTGGCTGCATATTTGCAGAAATGTTTCGTAGAAAGCCTCTTTTTCGTGGAAGTTCAGATGTTGATCAACTAGGAAAAATCTTGGACGTGATTGGACTCCCAGGAGAAGAAGACTGGCCTAGAGATGTTGCCCTTCCCAGGCAGGCTTTTCATTCAAAATCTGCCCAACCAATTGAGAAGTTTGTAACAGATATCGATGAACTAGGCAAAGACCTACTTCTGAAGTGTTTGACATTTAACCCAGCCAAAAGAATATCTGCCTACAGTGCCCTGTCTCACCCATACTTCCAGGACCTGGAAAGGTGCAAAGAAAACCTGGATTCCCACCTGCCGCCCAGCCAGAACACCTCGGAGCTGAATACAGCCTGA
ORF Protein Sequence MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T89361-Ab Anti-CDK6 monoclonal antibody
    Target Antigen GM-Tg-g-T89361-Ag CDK6 protein
    ORF Viral Vector pGMLP000458 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMLP005302 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMLP005616 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMAP000280 Human CDK6 Adenovirus plasmid
    ORF Viral Vector pGMPC000873 Human CDK6 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000458 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMLP005302 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMLP005616 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMAP000280 Human CDK6 Adenovirus particle


    Target information

    Target ID GM-T89361
    Target Name CDK6
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1021
    Gene ID 100037415 (Felis catus), 100061625 (Equus caballus), 1021 (Homo sapiens), 114483 (Rattus norvegicus)
    12571 (Mus musculus), 511754 (Bos taurus), 609920 (Canis lupus familiaris), 701822 (Macaca mulatta)
    Gene Symbols & Synonyms CDK6,Cdk6,MCPH12,PLSTIRE,Crk2
    Target Alternative Names CDK6,Cdk6,Cell division protein kinase 6,Crk2,Cyclin-dependent kinase 6,MCPH12,PLSTIRE,Serine/threonine-protein kinase PLSTIRE
    Uniprot Accession Q00534,Q64261
    Additional SwissProt Accessions: Q00534,Q64261
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, breast tumor
    Disease from KEGG p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Cushing syndrome, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Pancreatic cancer, Glioma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma
    Gene Ensembl ENSECAG00000016512, ENSG00000105810, ENSMUSG00000040274, ENSBTAG00000044023, ENSCAFG00845013226, ENSMMUG00000008698
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.