Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human HBEGF/DTSF ORF/cDNA clone-Adenovirus particle (BC033097)
Cat. No.: vGMAP000278
Pre-made Human HBEGF/DTSF Adenovirus for HBEGF overexpression in-vitro and in-vivo. The HBEGF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified HBEGF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
HBEGF/DTSF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000278 | Human HBEGF Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000278 |
| Gene Name | HBEGF |
| Accession Number | BC033097 |
| Gene ID | 1839 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 627 bp |
| Gene Alias | DTSF |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAAGCTGCTGCCGTCGGTGGTGCTGAAGCTCTTTCTGGCTGCAGTTCTCTCGGCACTGGTGACTGGCGAGAGCCTGGAGCGGCTTCGGAGAGGGCTAGCTGCTGGAACCAGCAACCCGGACCCTCCCACTGTATCCACGGACCAGCTGCTACCCCTAGGAGGCGGCCGGGACCGGAAAGTCCGTGACTTGCAAGAGGCAGATCTGGACCTTTTGAGAGTCACTTTATCCTCCAAGCCACAAGCACTGGCCACACCAAACAAGGAGGAGCACGGGAAAAGAAAGAAGAAAGGCAAGGGGCTAGGGAAGAAGAGGGACCCATGTCTTCGGAAATACAAGGACTTCTGCATCCATGGAGAATGCAAATATGTGAAGGAGCTCCGGGCTCCCTCCTGCATCTGCCACCCGGGTTACCATGGAGAGAGGTGTCATGGGCTGAGCCTCCCAGTGGAAAATCGCTTATATACCTATGACCACACAACCATCCTGGCCGTGGTGGCTGTGGTGCTGTCATCTGTCTGTCTGCTGGTCATCGTGGGGCTTCTCATGTTTAGGTACCATAGGAGAGGAGGTTATGATGTGGAAAATGAAGAGAAAGTGAAGTTGGGCATGACTAATTCCCACTGA |
| ORF Protein Sequence | MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T76093-Ab | Anti-HBEGF/ DTR/ DTS monoclonal antibody |
| Target Antigen | GM-Tg-g-T76093-Ag | HBEGF VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000457 | Human HBEGF Lentivirus plasmid |
| ORF Viral Vector | pGMAP000278 | Human HBEGF Adenovirus plasmid |
| ORF Viral Vector | vGMLP000457 | Human HBEGF Lentivirus particle |
| ORF Viral Vector | vGMAP000278 | Human HBEGF Adenovirus particle |
Target information
| Target ID | GM-T76093 |
| Target Name | HBEGF |
|
Gene Group Identifier （Target Gene ID in Homo species) |
1839 |
| Gene ID |
100629956 (Equus caballus), 101093578 (Felis catus), 15200 (Mus musculus), 1839 (Homo sapiens) 25433 (Rattus norvegicus), 522921 (Bos taurus), 607007 (Canis lupus familiaris), 695559 (Macaca mulatta) |
| Gene Symbols & Synonyms | HBEGF,Hbegf,Dtr,Dts,Hegfl,DTR,DTS,DTSF,HEGFL,GFHB,Hb-egf,HB-EGF |
| Target Alternative Names | DTR,DTS,DTSF,Dtr,Dts,GFHB,HB-EGF,HBEGF,HEGFL,Hb-egf,Hbegf,Hegfl,Proheparin-binding EGF-like growth factor |
| Uniprot Accession |
Q06175,Q06186,Q99075
Additional SwissProt Accessions: Q06186,Q99075,Q06175 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Urinary Tract Infection, Overactive bladder |
| Disease from KEGG | Endocrine resistance, ErbB signaling pathway, GnRH signaling pathway, Parathyroid hormone synthesis, secretion and action, Epithelial cell signaling in Helicobacter pylori infection, Proteoglycans in cancer, Bladder cancer |
| Gene Ensembl | ENSMUSG00000024486, ENSG00000113070, ENSBTAG00000021766, ENSCAFG00845001249, ENSMMUG00000060742 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.