Human SLPI/ALK1/ALP ORF/cDNA clone-Adenovirus particle (BC020708)

Cat. No.: vGMAP000268

Pre-made Human SLPI/ALK1/ALP Adenovirus for SLPI overexpression in-vitro and in-vivo. The SLPI adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SLPI-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to SLPI/ALK1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000268 Human SLPI Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000268
Gene Name SLPI
Accession Number BC020708
Gene ID 6590
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 399 bp
Gene Alias ALK1,ALP,BLPI,HUSI,HUSI-I,MPI,WAP4,WFDC4
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAGTCCAGCGGCCTCTTCCCCTTCCTGGTGCTGCTTGCCCTGGGAACTCTGGCACCTTGGGCTGTGGAAGGCTCTGGAAAGTCCTTCAAAGCTGGAGTCTGTCCTCCTAAGAAATCTGCCCAGTGCCTTAGATACAAGAAACCTGAGTGCCAGAGTGACTGGCAGTGTCCAGGGAAGAAGAGATGTTGTCCTGACACTTGTGGCATCAAATGCCTGGATCCTGTTGACACCCCAAACCCAACAAGGAGGAAGCCTGGGAAGTGCCCAGTGACTTATGGCCAATGTTTGATGCTTAACCCCCCCAATTTCTGTGAGATGGATGGCCAGTGCAAGCGTGACTTGAAGTGTTGCATGGGCATGTGTGGGAAATCCTGCGTTTCCCCTGTGAAAGCTTGA
ORF Protein Sequence MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1292-Ab Anti-SLPI/ ALK1/ ALP functional antibody
    Target Antigen GM-Tg-g-SE1292-Ag SLPI protein
    ORF Viral Vector pGMLP000454 Human SLPI Lentivirus plasmid
    ORF Viral Vector pGMAP000268 Human SLPI Adenovirus plasmid
    ORF Viral Vector vGMLP000454 Human SLPI Lentivirus particle
    ORF Viral Vector vGMAP000268 Human SLPI Adenovirus particle


    Target information

    Target ID GM-SE1292
    Target Name SLPI
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6590
    Gene ID 101090682 (Felis catus), 20568 (Mus musculus), 6590 (Homo sapiens), 711156 (Macaca mulatta)
    84386 (Rattus norvegicus)
    Gene Symbols & Synonyms SLPI,Slpi,ALP,MPI,ALK1,BLPI,HUSI,WAP4,WFDC4,HUSI-I
    Target Alternative Names ALK1,ALP,Antileukoproteinase,BLPI,HUSI,HUSI-1,HUSI-I,MPI,Mucus proteinase inhibitor (MPI),Protease inhibitor WAP4,SLPI,Secretory leukocyte protease inhibitor,Seminal proteinase inhibitor,Slpi,WAP four-disulfide core domain protein 4,WAP4,WFDC4
    Uniprot Accession P03973,P97430
    Additional SwissProt Accessions: P97430,P03973
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000017002, ENSG00000124107, ENSMMUG00000050091
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.