Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CGA/CG-ALPHA/FSHA ORF/cDNA clone-Adenovirus particle (BC020782)
Cat. No.: vGMAP000267
Pre-made Human CGA/CG-ALPHA/FSHA Adenovirus for CGA overexpression in-vitro and in-vivo. The CGA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CGA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
hCG Alpha/CGA/CGA/CG-ALPHA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000267 | Human CGA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000267 |
| Gene Name | CGA |
| Accession Number | BC020782 |
| Gene ID | 1081 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 351 bp |
| Gene Alias | CG-ALPHA,FSHA,GPHa,GPHA1,HCG,LHA,TSHA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCATGTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCATTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCATATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAGTCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTGGAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAA |
| ORF Protein Sequence | MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T16650-Ab | Anti-GLHA/ CGA/ CG-ALPHA functional antibody |
| Target Antigen | GM-Tg-g-T16650-Ag | CGA protein |
| ORF Viral Vector | pGMAP000121 | Human CGA Adenovirus plasmid |
| ORF Viral Vector | pGMAP000267 | Human CGA Adenovirus plasmid |
| ORF Viral Vector | vGMAP000121 | Human CGA Adenovirus particle |
| ORF Viral Vector | vGMAP000267 | Human CGA Adenovirus particle |
Target information
| Target ID | GM-T16650 |
| Target Name | hCG Alpha/CGA |
|
Gene Group Identifier （Target Gene ID in Homo species) |
1081 |
| Gene ID |
100034174 (Equus caballus), 1081 (Homo sapiens), 116700 (Rattus norvegicus), 12640 (Mus musculus) 280749 (Bos taurus), 403483 (Canis lupus familiaris), 697859 (Macaca mulatta), 751819 (Felis catus) |
| Gene Symbols & Synonyms | CGA,Cga,CG,GPA1,HCG,LHA,FSHA,GPHa,TSHA,GPHA1,CG-ALPHA,Gpa1,Tsha,aGSU,alphaSU,CG-alpha,GPHalpha,alphaGSU,alpha-GSU,FSH-alpha,LSH-alpha,TSH-alpha |
| Target Alternative Names | Anterior pituitary glycoprotein hormones common subunit alpha,CG,CG-ALPHA,CG-alpha,CGA,Cga,Choriogonadotropin alpha chain,Chorionic gonadotrophin subunit alpha (CG-alpha),FSH-alpha,FSHA,Follicle-stimulating hormone alpha chain (FSH-alpha),Follitropin alpha chain,GPA1,GPHA1,GPHa,GPHalpha,Glycoprotein hormones alpha chain,Gpa1,HCG,LHA,LSH-alpha,Luteinizing hormone alpha chain (LSH-alpha),Lutropin alpha chain,TSH-alpha,TSHA,Thyroid-stimulating hormone alpha chain (TSH-alpha),Thyrotropin alpha chain,Tsha,aGSU,alpha-GSU,alphaGSU,alphaSU,hCG Alpha |
| Uniprot Accession |
P01215,P01216,P01217,P01220,P11962,P22762,Q52R91,Q9XSW8
Additional SwissProt Accessions: P01220,P01215,P11962,P01216,P01217,Q9XSW8,P22762,Q52R91 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Drug Abuse |
| Disease from KEGG | cAMP signaling pathway, Neuroactive ligand-receptor interaction, GnRH signaling pathway, Ovarian steroidogenesis, Prolactin signaling pathway, Thyroid hormone synthesis, Regulation of lipolysis in adipocytes, GnRH secretion, Autoimmune thyroid disease |
| Gene Ensembl | ENSECAG00000018841, ENSG00000135346, ENSMUSG00000028298, ENSBTAG00000016138, ENSCAFG00845005481, ENSMMUG00000000222 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.