Human CD74/HLADG/Ia-GAMMA ORF/cDNA clone-Adenovirus particle (BC018726)

Cat. No.: vGMAP000261

Pre-made Human CD74/HLADG/Ia-GAMMA Adenovirus for CD74 overexpression in-vitro and in-vivo. The CD74 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CD74-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CD74/HLADG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000261 Human CD74 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000261
Gene Name CD74
Accession Number BC018726
Gene ID 972
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 699 bp
Gene Alias HLADG,Ia-GAMMA,protein 41
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCCGCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATGGAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGTTTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGAAAGAGTCACTGGAACTGGAGGACCCGTCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATGTGA
ORF Protein Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-344 Pre-Made Milatuzumab biosimilar, Whole mAb, Anti-CD74 Antibody: Anti-CLIP/DHLAG/HLADG/II/Ia-GAMMA/p33 therapeutic antibody
    Target Antibody GM-Tg-g-T08231-Ab Anti-HG2A/ CD74/ DHLAG monoclonal antibody
    Target Antigen GM-Tg-g-T08231-Ag CD74 VLP (virus-like particle)
    ORF Viral Vector pGMLP004927 Human CD74 Lentivirus plasmid
    ORF Viral Vector pGMAP000261 Human CD74 Adenovirus plasmid
    ORF Viral Vector pGMPC001530 Human CD74 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004927 Human CD74 Lentivirus particle
    ORF Viral Vector vGMAP000261 Human CD74 Adenovirus particle


    Target information

    Target ID GM-T08231
    Target Name CD74
    Gene Group Identifier
    (Target Gene ID in Homo species)
    972
    Gene ID 100071644 (Equus caballus), 101085953 (Felis catus), 16149 (Mus musculus), 25599 (Rattus norvegicus)
    479329 (Canis lupus familiaris), 613384 (Bos taurus), 710820 (Macaca mulatta), 972 (Homo sapiens)
    Gene Symbols & Synonyms CD74,Cd74,Ii,CLIP,DHLAG,HLADG,Ia-GAMMA,INVG34,II,p33
    Target Alternative Names CD74,CLIP,Cd74,DHLAG,HLA class II histocompatibility antigen gamma chain,HLA-DR antigens-associated invariant chain,HLADG,II,INVG34,Ia antigen-associated invariant chain (Ii),Ia-GAMMA,Ii,p33
    Uniprot Accession P04233,P04441,P10247
    Additional SwissProt Accessions: P04441,P10247,P04233
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease cancer
    Disease from KEGG Antigen processing and presentation, Tuberculosis
    Gene Ensembl ENSECAG00000008503, ENSMUSG00000024610, ENSCAFG00845006874, ENSBTAG00000015228, ENSMMUG00000009113, ENSG00000019582
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.