Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human YWHAQ/1C5/HS1 ORF/cDNA clone-Adenovirus particle (BC056867)
Cat. No.: vGMAP000259
Pre-made Human YWHAQ/1C5/HS1 Adenovirus for YWHAQ overexpression in-vitro and in-vivo. The YWHAQ adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified YWHAQ-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
41701/YWHAQ/YWHAQ/1C5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000259 | Human YWHAQ Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000259 |
| Gene Name | YWHAQ |
| Accession Number | BC056867 |
| Gene ID | 10971 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 738 bp |
| Gene Alias | 1C5,HS1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGAGAAGACTGAGCTGATCCAGAAGGCCAAGCTGGCCGAGCAGGCCGAGCGCTACGACGACATGGCCACCTGCATGAAGGCAGTGACCGAGCAGGGCGCCGAGCTGTCCAACGAGGAGCGCAACCTGCTCTCCGTGGCCTACAAGAACGTGGTCGGGGGCCGCAGGTCCGCCTGGAGGGTCATCTCTAGCATCGAGCAGAAGACCGACACCTCCGACAAGAAGTTGCAGCTGATTAAGGACTATCGGGAGAAAGTGGAGTCCGAGCTGAGATCCATCTGCACCACGGTGCTGGAATTGTTGGATAAATATTTAATAGCCAATGCAACTAATCCAGAGAGTAAGGTCTTCTATCTGAAAATGAAGGGTGATTACTTCCGGTACCTTGCTGAAGTTGCGTGTGGTGATGATCGAAAACAAACGATAGATAATTCCCAAGGAGCTTACCAAGAGGCATTTGATATAAGCAAGAAAGAGATGCAACCCACACACCCAATCCGCCTGGGGCTTGCTCTTAACTTTTCTGTATTTTACTATGAGATTCTTAATAACCCAGAGCTTGCCTGCACGCTGGCTAAAACGGCTTTTGATGAGGCCATTGCTGAACTTGATACACTGAATGAAGACTCATACAAAGACAGCACCCTCATCATGCAGTTGCTTAGAGACAACCTAACACTTTGGACATCAGACAGTGCAGGAGAAGAATGTGATGCGGCAGAAGGGGCTGAAAACTAA |
| ORF Protein Sequence | MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2293-Ab | Anti-YWHAQ monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2293-Ag | YWHAQ protein |
| ORF Viral Vector | pGMLP000536 | Human YWHAQ Lentivirus plasmid |
| ORF Viral Vector | pGMAP000259 | Human YWHAQ Adenovirus plasmid |
| ORF Viral Vector | vGMLP000536 | Human YWHAQ Lentivirus particle |
| ORF Viral Vector | vGMAP000259 | Human YWHAQ Adenovirus particle |
Target information
| Target ID | GM-IP2293 |
| Target Name | 41701/YWHAQ |
|
Gene Group Identifier （Target Gene ID in Homo species) |
10971 |
| Gene ID |
100057123 (Equus caballus), 101088481 (Felis catus), 10971 (Homo sapiens), 22630 (Mus musculus) 25577 (Rattus norvegicus), 607060 (Canis lupus familiaris), 694702 (Macaca mulatta), 768311 (Bos taurus) |
| Gene Symbols & Synonyms | YWHAQ,Ywhaq,1C5,HS1,14-3-3,2700028P07Rik,14-3-3t |
| Target Alternative Names | 14-3-3,14-3-3 protein T-cell,14-3-3 protein tau,14-3-3 protein theta,14-3-3t,1C5,2700028P07Rik,41701,HS1,Protein HS1,YWHAQ,Ywhaq |
| Uniprot Accession |
P27348,P68254,P68255,Q3SZI4
Additional SwissProt Accessions: P27348,P68254,P68255,Q3SZI4 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | Lung Cancer |
| Disease from KEGG | PI3K-Akt signaling pathway, Hippo signaling pathway, Hepatitis C, Hepatitis B |
| Gene Ensembl | ENSECAG00000004925, ENSG00000134308, ENSMUSG00000076432, ENSCAFG00845025457, ENSMMUG00000006965, ENSBTAG00000002108 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.