Human YWHAQ/1C5/HS1 ORF/cDNA clone-Adenovirus particle (BC056867)

Cat. No.: vGMAP000259

Pre-made Human YWHAQ/1C5/HS1 Adenovirus for YWHAQ overexpression in-vitro and in-vivo. The YWHAQ adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified YWHAQ-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to 41701/YWHAQ/YWHAQ/1C5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000259 Human YWHAQ Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000259
Gene Name YWHAQ
Accession Number BC056867
Gene ID 10971
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 738 bp
Gene Alias 1C5,HS1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGAAGACTGAGCTGATCCAGAAGGCCAAGCTGGCCGAGCAGGCCGAGCGCTACGACGACATGGCCACCTGCATGAAGGCAGTGACCGAGCAGGGCGCCGAGCTGTCCAACGAGGAGCGCAACCTGCTCTCCGTGGCCTACAAGAACGTGGTCGGGGGCCGCAGGTCCGCCTGGAGGGTCATCTCTAGCATCGAGCAGAAGACCGACACCTCCGACAAGAAGTTGCAGCTGATTAAGGACTATCGGGAGAAAGTGGAGTCCGAGCTGAGATCCATCTGCACCACGGTGCTGGAATTGTTGGATAAATATTTAATAGCCAATGCAACTAATCCAGAGAGTAAGGTCTTCTATCTGAAAATGAAGGGTGATTACTTCCGGTACCTTGCTGAAGTTGCGTGTGGTGATGATCGAAAACAAACGATAGATAATTCCCAAGGAGCTTACCAAGAGGCATTTGATATAAGCAAGAAAGAGATGCAACCCACACACCCAATCCGCCTGGGGCTTGCTCTTAACTTTTCTGTATTTTACTATGAGATTCTTAATAACCCAGAGCTTGCCTGCACGCTGGCTAAAACGGCTTTTGATGAGGCCATTGCTGAACTTGATACACTGAATGAAGACTCATACAAAGACAGCACCCTCATCATGCAGTTGCTTAGAGACAACCTAACACTTTGGACATCAGACAGTGCAGGAGAAGAATGTGATGCGGCAGAAGGGGCTGAAAACTAA
ORF Protein Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2293-Ab Anti-YWHAQ monoclonal antibody
    Target Antigen GM-Tg-g-IP2293-Ag YWHAQ protein
    ORF Viral Vector pGMLP000536 Human YWHAQ Lentivirus plasmid
    ORF Viral Vector pGMAP000259 Human YWHAQ Adenovirus plasmid
    ORF Viral Vector vGMLP000536 Human YWHAQ Lentivirus particle
    ORF Viral Vector vGMAP000259 Human YWHAQ Adenovirus particle


    Target information

    Target ID GM-IP2293
    Target Name 41701/YWHAQ
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10971
    Gene ID 100057123 (Equus caballus), 101088481 (Felis catus), 10971 (Homo sapiens), 22630 (Mus musculus)
    25577 (Rattus norvegicus), 607060 (Canis lupus familiaris), 694702 (Macaca mulatta), 768311 (Bos taurus)
    Gene Symbols & Synonyms YWHAQ,Ywhaq,1C5,HS1,14-3-3,2700028P07Rik,14-3-3t
    Target Alternative Names 14-3-3,14-3-3 protein T-cell,14-3-3 protein tau,14-3-3 protein theta,14-3-3t,1C5,2700028P07Rik,41701,HS1,Protein HS1,YWHAQ,Ywhaq
    Uniprot Accession P27348,P68254,P68255,Q3SZI4
    Additional SwissProt Accessions: P27348,P68254,P68255,Q3SZI4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Lung Cancer
    Disease from KEGG PI3K-Akt signaling pathway, Hippo signaling pathway, Hepatitis C, Hepatitis B
    Gene Ensembl ENSECAG00000004925, ENSG00000134308, ENSMUSG00000076432, ENSCAFG00845025457, ENSMMUG00000006965, ENSBTAG00000002108
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.