Human HMGB1/HMG3/SBP-1 ORF/cDNA clone-Adenovirus particle (BC030981)
Cat. No.: vGMAP000231
Pre-made Human HMGB1/HMG3/SBP-1 Adenovirus for HMGB1 overexpression in-vitro and in-vivo. The HMGB1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified HMGB1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
HMGB1/HMG3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000231 | Human HMGB1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000231 |
| Gene Name | HMGB1 |
| Accession Number | BC030981 |
| Gene ID | 3146 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 648 bp |
| Gene Alias | HMG3,SBP-1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTCGGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACATCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGACAAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAGCTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGAGGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAAGATGATGATGATGAATAA |
| ORF Protein Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T63595-Ab | Anti-HMGB1/ HMG-1/ HMG1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T63595-Ag | HMGB1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP001892 | Human HMGB1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002391 | Human HMGB1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000070 | Human HMGB1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000231 | Human HMGB1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000590 | Human HMGB1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC004728 | Human HMGB1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP001892 | Human HMGB1 Lentivirus particle |
| ORF Viral Vector | vGMLV002391 | Human HMGB1 Lentivirus particle |
| ORF Viral Vector | vGMAP000070 | Human HMGB1 Adenovirus particle |
| ORF Viral Vector | vGMAP000231 | Human HMGB1 Adenovirus particle |
Target information
| Target ID | GM-T63595 |
| Target Name | HMGB1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3146 |
| Gene ID |
100033873 (Equus caballus), 101089823 (Felis catus), 15289 (Mus musculus), 25459 (Rattus norvegicus) 282691 (Bos taurus), 3146 (Homo sapiens), 403170 (Canis lupus familiaris), 712849 (Macaca mulatta) |
| Gene Symbols & Synonyms | HMGB1,Hmgb1,HMG-1,p30,Hmg1,SBP-1,Ac2-008,HMG1,HMG3 |
| Target Alternative Names | Ac2-008,HMG-1,HMG1,HMG3,HMGB1,High mobility group protein 1 (HMG-1),High mobility group protein B1,Hmg1,Hmgb1,SBP-1,p30 |
| Uniprot Accession |
P09429,P10103,P63158,P63159,Q08IE6,Q6YKA4
Additional SwissProt Accessions: Q08IE6,P63158,P63159,P10103,P09429,Q6YKA4 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Ovary Cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000008439, ENSMUSG00000066551, ENSBTAG00000018103, ENSG00000189403, ENSCAFG00845021967, ENSMMUG00000046615 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


