Human AREG/AR/CRDGF ORF/cDNA clone-Adenovirus particle (BC009799)

Cat. No.: vGMAP000225

Pre-made Human AREG/AR/CRDGF Adenovirus for AREG overexpression in-vitro and in-vivo. The AREG adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified AREG-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Amphiregulin/AREG/AREG/AR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000225 Human AREG Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000225
Gene Name AREG
Accession Number BC009799
Gene ID 374
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 759 bp
Gene Alias AR,CRDGF
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGAGCCCCGCTGCTACCGCCGGCGCCGGTGGTGCTGTCGCTCTTGATACTCGGCTCAGGCCATTATGCTGCTGGATTGGACCTCAATGACACCTACTCTGGGAAGCGTGAACCATTTTCTGGGGACCACAGTGCTGATGGATTTGAGGTTACCTCAAGAAGTGAGATGTCTTCAGGGAGTGAGATTTCCCCTGTGAGTGAAATGCCTTCTAGTAGTGAACCGTCCTCGGGAGCCGACTATGACTACTCAGAAGAGTATGATAACGAACCACAAATACCTGGCTATATTGTCGATGATTCAGTCAGAGTTGAACAGGTAGTTAAGCCCCCCCAAAACAAGACGGAAAGTGAAAATACTTCAGATAAACCCAAAAGAAAGAAAAAGGGAGGCAAAAATGGAAAAAATAGAAGAAACAGAAAGAAGAAAAATCCATGTAATGCAGAATTTCAAAATTTCTGCATTCACGGAGAATGCAAATATATAGAGCACCTGGAAGCAGTAACATGCAAATGTCAGCAAGAATATTTCGGTGAACGGTGTGGGGAAAAGTCCATGAAAACTCACAGCATGATTGACAGTAGTTTATCAAAAATTGCATTAGCAGCCATAGCTGCCTTTATGTCTGCTGTGATCCTCACAGCTGTTGCTGTTATTACAGTCCAGCTTAGAAGACAATACGTCAGGAAATATGAAGGAGAAGCTGAGGAACGAAAGAAACTTCGACAAGAGAATGGAAATGTACATGCTATAGCATAA
ORF Protein Sequence MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T92834-Ab Anti-AREG/ ARB/ CRDGF functional antibody
    Target Antigen GM-Tg-g-T92834-Ag AREG protein
    Cytokine cks-Tg-g-GM-T92834 amphiregulin (AREG) protein & antibody
    ORF Viral Vector pGMLP000520 Human AREG Lentivirus plasmid
    ORF Viral Vector pGMAP000225 Human AREG Adenovirus plasmid
    ORF Viral Vector vGMLP000520 Human AREG Lentivirus particle
    ORF Viral Vector vGMAP000225 Human AREG Adenovirus particle


    Target information

    Target ID GM-T92834
    Target Name Amphiregulin/AREG
    Gene Group Identifier
    (Target Gene ID in Homo species)
    374
    Gene ID 100050528 (Equus caballus), 101081041 (Felis catus), 11839 (Mus musculus), 29183 (Rattus norvegicus)
    374 (Homo sapiens), 475176 (Canis lupus familiaris), 538751 (Bos taurus), 702396 (Macaca mulatta)
    Gene Symbols & Synonyms AREG,Areg,AR,Mcub,Sdgf,SDGF,AREGB,CRDGF
    Target Alternative Names AR,AREG,AREGB,Amphiregulin,Areg,CRDGF,Colorectum cell-derived growth factor (CRDGF),Mcub,SDGF,Sdgf
    Uniprot Accession P15514,P24338,P31955
    Additional SwissProt Accessions: P31955,P24338,P15514
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG MAPK signaling pathway, ErbB signaling pathway, PI3K-Akt signaling pathway, Hippo signaling pathway, Colorectal cancer
    Gene Ensembl ENSECAG00000022525, ENSMUSG00000029378, ENSG00000109321, ENSCAFG00845006713, ENSBTAG00000018134, ENSMMUG00000002314
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.