Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human PTHLH/HHM/MGC14611 ORF/cDNA clone-Adenovirus particle (BC005961)
Cat. No.: vGMAP000211
Pre-made Human PTHLH/HHM/MGC14611 Adenovirus for PTHLH overexpression in-vitro and in-vivo. The PTHLH adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PTHLH-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
PTHLH/HHM products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000211 | Human PTHLH Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000211 |
| Gene Name | PTHLH |
| Accession Number | BC005961 |
| Gene ID | 5744 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 528 bp |
| Gene Alias | HHM,MGC14611,PLP,PTHR,PTHRP |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGCAGCGGAGACTGGTTCAGCAGTGGAGCGTCGCGGTGTTCCTGCTGAGCTACGCGGTGCCCTCCTGCGGGCGCTCGGTGGAGGGTCTCAGCCGCCGCCTCAAAAGAGCTGTGTCTGAACATCAGCTCCTCCATGACAAGGGGAAGTCCATCCAAGATTTACGGCGACGATTCTTCCTTCACCATCTGATCGCAGAAATCCACACAGCTGAAATCAGAGCTACCTCGGAGGTGTCCCCTAACTCCAAGCCCTCTCCCAACACAAAGAACCACCCCGTCCGATTTGGGTCTGATGATGAGGGCAGATACCTAACTCAGGAAACTAACAAGGTGGAGACGTACAAAGAGCAGCCGCTCAAGACACCTGGGAAGAAAAAGAAAGGCAAGCCCGGGAAACGCAAGGAGCAGGAAAAGAAAAAACGGCGAACTCGCTCTGCCTGGTTAGACTCTGGAGTGACTGGGAGTGGGCTAGAAGGGGACCACCTGTCTGACACCTCCACAACGTCGCTGGAGCTCGATTCACGGTAA |
| ORF Protein Sequence | MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1230-Ab | Anti-PTHR/ PTHLH/ BDE2 functional antibody |
| Target Antigen | GM-Tg-g-SE1230-Ag | PTHLH protein |
| ORF Viral Vector | pGMLP000529 | Human PTHLH Lentivirus plasmid |
| ORF Viral Vector | pGMLV001901 | Human PTHLH Lentivirus plasmid |
| ORF Viral Vector | pGMAP000211 | Human PTHLH Adenovirus plasmid |
| ORF Viral Vector | vGMLP000529 | Human PTHLH Lentivirus particle |
| ORF Viral Vector | vGMLV001901 | Human PTHLH Lentivirus particle |
| ORF Viral Vector | vGMAP000211 | Human PTHLH Adenovirus particle |
Target information
| Target ID | GM-SE1230 |
| Target Name | PTHLH |
|
Gene Group Identifier （Target Gene ID in Homo species) |
5744 |
| Gene ID |
100033979 (Equus caballus), 19227 (Mus musculus), 24695 (Rattus norvegicus), 286767 (Bos taurus) 403987 (Canis lupus familiaris), 554222 (Felis catus), 5744 (Homo sapiens), 710295 (Macaca mulatta) |
| Gene Symbols & Synonyms | PTHLH,Pthlh,PTHrP,PLP,Pthrp,PTH-like,PTHRP,HHM,BDE2,PTHR |
| Target Alternative Names | BDE2,HHM,PLP,PTH-like,PTH-rP,PTHLH,PTHR,PTHRP,PTHrP,Parathyroid hormone-like protein (PLP),Parathyroid hormone-related protein,Pthlh,Pthrp |
| Uniprot Accession |
P12272,P13085,P22858,P52211,P58073,Q9GMB7
Additional SwissProt Accessions: Q9GMB7,P22858,P13085,P58073,P52211,P12272 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | cancer, Lung cancer |
| Disease from KEGG | Parathyroid hormone synthesis, secretion and action |
| Gene Ensembl | ENSECAG00000014708, ENSMUSG00000048776, ENSBTAG00000006538, ENSCAFG00845022996, ENSG00000087494, ENSMMUG00000010531 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.