Human CCK ORF/cDNA clone-Adenovirus particle (BC008283)

Cat. No.: vGMAP000203

Pre-made Human CCK/ Adenovirus for CCK overexpression in-vitro and in-vivo. The CCK adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CCK-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CCK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000203 Human CCK Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000203
Gene Name CCK
Accession Number BC008283
Gene ID 885
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 348 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAACAGCGGCGTGTGCCTGTGCGTGCTGATGGCGGTACTGGCGGCTGGCGCCCTGACGCAGCCGGTGCCTCCCGCAGATCCCGCGGGCTCCGGGCTGCAGCGGGCAGAGGAGGCGCCCCGTAGGCAGCTGAGGGTATCGCAGAGAACGGATGGCGAGTCCCGAGCGCACCTGGGCGCCCTGCTGGCAAGATACATCCAGCAGGCCCGGAAAGCTCCTTCTGGACGAATGTCCATCGTTAAGAACCTGCAGAACCTGGACCCCAGCCACAGGATAAGTGACCGGGACTACATGGGCTGGATGGATTTTGGCCGTCGCAGTGCCGAGGAGTATGAGTACCCCTCCTAG
ORF Protein Sequence MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T24089-Ab Anti-CCKN/ CCK functional antibody
    Target Antigen GM-Tg-g-T24089-Ag CCK protein
    ORF Viral Vector pGMLP000525 Human CCK Lentivirus plasmid
    ORF Viral Vector pGMAP000203 Human CCK Adenovirus plasmid
    ORF Viral Vector vGMLP000525 Human CCK Lentivirus particle
    ORF Viral Vector vGMAP000203 Human CCK Adenovirus particle


    Target information

    Target ID GM-T24089
    Target Name CCK
    Gene Group Identifier
    （Target Gene ID in Homo species)         		885
    Gene ID 100055193 (Equus caballus), 100430777 (Macaca mulatta), 101096837 (Felis catus), 12424 (Mus musculus)
    25298 (Rattus norvegicus), 609547 (Canis lupus familiaris), 617510 (Bos taurus), 885 (Homo sapiens)
    Gene Symbols & Synonyms CCK,Cck
    Target Alternative Names CCK,Cck,Cholecystokinin
    Uniprot Accession P01355,P06307,P09240,P41520,Q9TS44
    Additional SwissProt Accessions: P09240,P01355,Q9TS44,P41520,P06307
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Neuroactive ligand-receptor interaction, Insulin secretion, Pancreatic secretion
    Gene Ensembl ENSECAG00000014143, ENSMMUG00000001077, ENSMUSG00000032532, ENSCAFG00845019239, ENSBTAG00000056680, ENSG00000187094
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.