Human CD9/BTCC-1/DRAP-27 ORF/cDNA clone-Adenovirus particle (XM005253814.3)
Cat. No.: vGMAP000191
Pre-made Human CD9/BTCC-1/DRAP-27 Adenovirus for CD9 overexpression in-vitro and in-vivo. The CD9 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CD9-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CD9/BTCC-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000191 | Human CD9 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000191 |
| Gene Name | CD9 |
| Accession Number | XM005253814.3 |
| Gene ID | 928 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 750 bp |
| Gene Alias | BTCC-1,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGGTATGTCGCCTTGGCAAAGACACCCTCCTGCGCTTTCTCCGGATTGTGTCTGCACACAGGGTGCTGACTGCACCAGACCAGTGCAAACATTCTAATCGTCTTCTTACAATTTGTTTCTCTCATCCCCATCCCTGCCTTCTCGCTGTAGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGGTAAACTCAGACCAGGATCCTGGTGTCCCTGCCCCCATTGCTCTGGACAAACCCTGCAAGCATGA |
| ORF Protein Sequence | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVELLWFGWGRGTVYLRHLPQEGRTRNLHREGKLRPGSWCPCPHCSGQTLQA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T50574-Ab | Anti-CD9/ BTCC-1/ DRAP-27 monoclonal antibody |
| Target Antigen | GM-Tg-g-T50574-Ag | CD9 VLP (virus-like particle) |
| ORF Viral Vector | pGMAP000191 | Human CD9 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000682 | Human CD9 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMAP000191 | Human CD9 Adenovirus particle |
Target information
| Target ID | GM-T50574 |
| Target Name | CD9 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
928 |
| Gene ID |
100059512 (Equus caballus), 12527 (Mus musculus), 24936 (Rattus norvegicus), 280746 (Bos taurus) 493874 (Felis catus), 611695 (Canis lupus familiaris), 712262 (Macaca mulatta), 928 (Homo sapiens) |
| Gene Symbols & Synonyms | CD9,Cd9,Tspan29,MIC3,MRP-1,BTCC-1,DRAP-27,TSPAN29,TSPAN-29 |
| Target Alternative Names | 5H9 antigen,BTCC-1,CD9,CD9 antigen,Cd9,Cell growth-inhibiting gene 2 protein,DRAP-27,Leukocyte antigen MIC3,MIC3,MRP-1,Motility-related protein (MRP-1),TSPAN-29,TSPAN29,Tetraspanin-29 (Tspan-29),Tspan29,p24 |
| Uniprot Accession |
P21926,P30932,P40239,P40240,P40241
Additional SwissProt Accessions: P40240,P40241,P30932,P40239,P21926 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | cancer |
| Disease from KEGG | Hematopoietic cell lineage |
| Gene Ensembl | ENSECAG00000003002, ENSMUSG00000030342, ENSBTAG00000014764, ENSCAFG00845029613, ENSMMUG00000004470, ENSG00000010278 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


