Human CDK4/CMM3/MGC14458 ORF/cDNA clone-Adenovirus particle (BC003644)

Cat. No.: vGMAP000163

Pre-made Human CDK4/CMM3/MGC14458 Adenovirus for CDK4 overexpression in-vitro and in-vivo. The CDK4 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CDK4-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CDK4/CMM3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000163 Human CDK4 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000163
Gene Name CDK4
Accession Number BC003644
Gene ID 1019
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 912 bp
Gene Alias CMM3,MGC14458,PSK-J3
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCTACCTCTCGATATGAGCCAGTGGCTGAAATTGGTGTCGGTGCCTATGGGACAGTGTACAAGGCCCGTGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTCCCCAATGGAGGAGGAGGTGGAGGAGGCCTTCCCATCAGCACAGTTCGTGAGGTGGCTTTACTGAGGCGACTGGAGGCTTTTGAGCATCCCAATGTTGTCCGGCTGATGGACGTCTGTGCCACATCCCGAACTGACCGGGAGATCAAGGTAACCCTGGTGTTTGAGCATGTAGACCAGGACCTAAGGACATATCTGGACAAGGCACCCCCACCAGGCTTGCCAGCCGAAACGATCAAGGATCTGATGCGCCAGTTTCTAAGAGGCCTAGATTTCCTTCATGCCAATTGCATCGTTCACCGAGATCTGAAGCCAGAGAACATTCTGGTGACAAGTGGTGGAACAGTCAAGCTGGCTGACTTTGGCCTGGCCAGAATCTACAGCTACCAGATGGCACTTACACCCGTGGTTGTTACACTCTGGTACCGAGCTCCCGAAGTTCTTCTGCAGTCCACATATGCAACACCTGTGGACATGTGGAGTGTTGGCTGTATCTTTGCAGAGATGTTTCGTCGAAAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTTGGGCAAAATCTTTGACCTGATTGGGCTGCCTCCAGAGGATGACTGGCCTCGAGATGTATCCCTGCCCCGTGGAGCCTTTCCCCCCAGAGGGCCCCGCCCAGTGCAGTCGGTGGTACCTGAGATGGAGGAGTCGGGAGCACAGCTGCTGCTGGAAATGCTGACTTTTAACCCACACAAGCGAATCTCTGCCTTTCGAGCTCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGAGTGA
ORF Protein Sequence MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85799-Ab Anti-CDK4 monoclonal antibody
    Target Antigen GM-Tg-g-T85799-Ag CDK4 protein
    ORF Viral Vector pGMLP005426 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMLP005615 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMLV000900 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMAP000163 Human CDK4 Adenovirus plasmid
    ORF Viral Vector vGMLP005426 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMLP005615 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMLV000900 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMAP000163 Human CDK4 Adenovirus particle


    Target information

    Target ID GM-T85799
    Target Name CDK4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1019
    Gene ID 100051005 (Equus caballus), 101097903 (Felis catus), 1019 (Homo sapiens), 12567 (Mus musculus)
    481131 (Canis lupus familiaris), 510618 (Bos taurus), 715650 (Macaca mulatta), 94201 (Rattus norvegicus)
    Gene Symbols & Synonyms CDK4,Cdk4,CMM3,PSK-J3,Crk3
    Target Alternative Names CDK4,CMM3,Cdk4,Cell division protein kinase 4,Crk3,Cyclin-dependent kinase 4,PSK-J3
    Uniprot Accession P11802,P30285,P35426,Q32KY4
    Additional SwissProt Accessions: P11802,P30285,Q32KY4,P35426
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Non-Small Cell Lung Cancer
    Disease from KEGG Endocrine resistance, p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Tight junction, T cell receptor signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Pancreatic cancer, Glioma, Melanoma, Bladder cancer, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma
    Gene Ensembl ENSECAG00000025015, ENSG00000135446, ENSMUSG00000006728, ENSCAFG00845013840, ENSBTAG00000007160, ENSMMUG00000023694
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.