Human PDGFRA/CD140A/PDGFR2 ORF/cDNA clone-Adenovirus particle (BC015186)

Cat. No.: vGMAP000154

Pre-made Human PDGFRA/CD140A/PDGFR2 Adenovirus for PDGFRA overexpression in-vitro and in-vivo. The PDGFRA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PDGFRA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to PDGFR alpha/CD140a/PDGFRA/PDGFRA/CD140A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000154 Human PDGFRA Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000154
Gene Name PDGFRA
Accession Number BC015186
Gene ID 5156
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 657 bp
Gene Alias CD140A,PDGFR2
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGGTACTTGTATCATCTCCTTCCTTCTTTAA
ORF Protein Sequence MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-393 Pre-Made Olaratumab biosimilar, Whole mAb, Anti-PDGFRA Antibody: Anti-CD140A/PDGFR-2/PDGFR2 therapeutic antibody
    Biosimilar GMP-Bios-ab-590 Pre-Made Tovetumab biosimilar, Whole mAb, Anti-PDGFRA Antibody: Anti-CD140A/PDGFR-2/PDGFR2 therapeutic antibody
    Target Antibody GM-Tg-g-T53524-Ab Anti-PGFRA/ PDGFRA/ CD140A monoclonal antibody
    Target Antigen GM-Tg-g-T53524-Ag PDGFRA VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T53524 Platelet-derived growth factor receptors (PDGF-R) are cell surface tyrosine kinase receptors for members of theplatelet-derived growth factor (PDGF) family. PDGF subunits -A and -B are important factors regulating cell proliferation, cellular differentiat (PDGFRA) protein & antibody
    ORF Viral Vector pGMLP005737 Human PDGFRA Lentivirus plasmid
    ORF Viral Vector pGMAP000154 Human PDGFRA Adenovirus plasmid
    ORF Viral Vector vGMLP005737 Human PDGFRA Lentivirus particle
    ORF Viral Vector vGMAP000154 Human PDGFRA Adenovirus particle


    Target information

    Target ID GM-T53524
    Target Name PDGFR alpha/CD140a/PDGFRA
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5156
    Gene ID 100059815 (Equus caballus), 101090765 (Felis catus), 18595 (Mus musculus), 25267 (Rattus norvegicus)
    282301 (Bos taurus), 442860 (Canis lupus familiaris), 5156 (Homo sapiens), 697002 (Macaca mulatta)
    Gene Symbols & Synonyms PDGFRA,Pdgfra,CD140a,Pdgfr-2,APDGFR,PDGFACE,CD140A,PDGFR2,PDGFR-2
    Target Alternative Names APDGFR,Alpha platelet-derived growth factor receptor,Alpha-type platelet-derived growth factor receptor,CD140 antigen-like family member A,CD140A,CD140a,CD140a antigen,PDGF-R-alpha,PDGFACE,PDGFR alpha,PDGFR-2,PDGFR-alpha,PDGFR2,PDGFRA,Pdgfr-2,Pdgfra,Platelet-derived growth factor alpha receptor,Platelet-derived growth factor receptor 2 (PDGFR-2),Platelet-derived growth factor receptor alpha
    Uniprot Accession P16234,P20786,P26618
    Additional SwissProt Accessions: P26618,P20786,P16234
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Non-Small Cell Lung Cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Gap junction, JAK-STAT signaling pathway, Regulation of actin cytoskeleton, Human cytomegalovirus infection, Pathways in cancer, Glioma, Prostate cancer, Melanoma, Central carbon metabolism in cancer, Choline metabolism in cancer
    Gene Ensembl ENSECAG00000018176, ENSMUSG00000029231, ENSBTAG00000007173, ENSCAFG00845011775, ENSG00000134853, ENSMMUG00000017395
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.