Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human PDGFB/c-sis/PDGF2 ORF/cDNA clone-Adenovirus particle (BC029822)
Cat. No.: vGMAP000122
Pre-made Human PDGFB/c-sis/PDGF2 Adenovirus for PDGFB overexpression in-vitro and in-vivo. The PDGFB adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PDGFB-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
PDGF-BB/PDGFB/PDGFBB/PDGFB/c-sis products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000122 | Human PDGFB Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000122 |
| Gene Name | PDGFB |
| Accession Number | BC029822 |
| Gene ID | 5155 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 726 bp |
| Gene Alias | c-sis,PDGF2,SSV |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAATCGCTGCTGGGCGCTCTTCCTGTCTCTCTGCTGCTACCTGCGTCTGGTCAGCGCCGAGGGGGACCCCATTCCCGAGGAGCTTTATGAGATGCTGAGTGACCACTCGATCCGCTCCTTTGATGATCTCCAACGCCTGCTGCACGGAGACCCCGGAGAGGAAGATGGGGCCGAGTTGGACCTGAACATGACCCGCTCCCACTCTGGAGGCGAGCTGGAGAGCTTGGCTCGTGGAAGAAGGAGCCTGGGTTCCCTGACCATTGCTGAGCCGGCCATGATCGCCGAGTGCAAGACGCGCACCGAGGTGTTCGAGATCTCCCGGCGCCTCATAGACCGCACCAACGCCAACTTCCTGGTGTGGCCGCCCTGTGTGGAGGTGCAGCGCTGCTCCGGCTGCTGCAACAACCGCAACGTGCAGTGCCGCCCCACCCAGGTGCAGCTGCGACCTGTCCAGGTGAGAAAGATCGAGATTGTGCGGAAGAAGCCAATCTTTAAGAAGGCCACGGTGACGCTGGAAGACCACCTGGCATGCAAGTGTGAGACAGTGGCAGCTGCACGGCCTGTGACCCGAAGCCCGGGGGGTTCCCAGGAGCAGCGAGCCAAAACGCCCCAAACTCGGGTGACCATTCGGACGGTGCGAGTCCGCCGGCCCCCCAAGGGCAAGCACCGGAAATTCAAGCACACGCATGACAAGACGGCACTGAAGGAGACCCTTGGAGCCTAG |
| ORF Protein Sequence | MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T87350-Ab | Anti-PDGFB/ IBGC5/ PDGF-2 functional antibody |
| Target Antigen | GM-Tg-g-T87350-Ag | PDGFB protein |
| Cytokine | cks-Tg-g-GM-T87350 | platelet derived growth factor subunit B (PDGFB) protein & antibody |
| ORF Viral Vector | pGMAP000122 | Human PDGFB Adenovirus plasmid |
| ORF Viral Vector | vGMAP000122 | Human PDGFB Adenovirus particle |
Target information
| Target ID | GM-T87350 |
| Target Name | PDGF-BB/PDGFB/PDGFBB |
|
Gene Group Identifier （Target Gene ID in Homo species) |
5155 |
| Gene ID |
100070283 (Equus caballus), 100135774 (Felis catus), 18591 (Mus musculus), 24628 (Rattus norvegicus) 442986 (Canis lupus familiaris), 5155 (Homo sapiens), 540106 (Bos taurus), 703173 (Macaca mulatta) |
| Gene Symbols & Synonyms | PDGFB,Pdgfb,SIS,cis,PDGF,PDGF-2,Sis,c-sis,PDGF-B,SSV,IBGC5,PDGF2 |
| Target Alternative Names | IBGC5,PDGF,PDGF subunit B,PDGF-2,PDGF-B,PDGF-BB,PDGF2,PDGFB,PDGFBB,Pdgfb,Platelet-derived growth factor B chain,Platelet-derived growth factor beta polypeptide,Platelet-derived growth factor subunit B,Proto-oncogene c-Sis,SIS,SSV,Sis,c-sis,cis |
| Uniprot Accession |
P01127,P12919,P31240,Q05028,Q6Q7I7
Additional SwissProt Accessions: P12919,P31240,Q05028,Q6Q7I7,P01127 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, Chronic Kidney Disease |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Gap junction, JAK-STAT signaling pathway, Regulation of actin cytoskeleton, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Renal cell carcinoma, Glioma, Prostate cancer, Melanoma, Choline metabolism in cancer, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000018472, ENSMUSG00000000489, ENSCAFG00845022039, ENSG00000100311, ENSBTAG00000021697, ENSMMUG00000002739 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.