Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human TGFA/TFGA ORF/cDNA clone-Adenovirus particle (BC005308)
Cat. No.: vGMAP000120
Pre-made Human TGFA/TFGA Adenovirus for TGFA overexpression in-vitro and in-vivo. The TGFA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TGFA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
TGF Alpha/TGFA/TGFA/TFGA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000120 | Human TGFA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000120 |
| Gene Name | TGFA |
| Accession Number | BC005308 |
| Gene ID | 7039 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | TFGA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGTCCCCTCGGCTGGACAGCTCGCCCTGTTCGCTCTGGGTATTGTGTTGGCTGCGTGCCAGGCCTTGGAGAACAGCACGTCCCCGCTGAGTGACCCGCCCGTGGCTGCAGCAGTGGTGTCCCATTTTAATGACTGCCCAGATTCCCACACTCAGTTCTGCTTCCATGGAACCTGCAGGTTTTTGGTGCAGGAGGACAAGCCAGCATGTGTCTGCCATTCTGGGTACGTTGGTGCACGCTGTGAGCATGCGGACCTCCTGGCCGTGGTGGCTGCCAGCCAGAAGAAGCAGGCCATCACCGCCTTGGTGGTGGTCTCCATCGTGGCCCTGGCTGTCCTTATCATCACATGTGTGCTGATACACTGCTGCCAGGTCCGAAAACACTGTGAGTGGTGCCGGGCCCTCATCTGCCGGCACGAGAAGCCCAGCGCCCTCCTGAAGGGAAGAACCGCTTGCTGCCACTCAGAAACAGTGGTCTGA |
| ORF Protein Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T00033-Ab | Anti-TGFA/ TFGA monoclonal antibody |
| Target Antigen | GM-Tg-g-T00033-Ag | TGFA VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T00033 | transforming growth factor, alpha (TGFA) protein & antibody |
| ORF Viral Vector | pGMLP000405 | Human TGFA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000120 | Human TGFA Adenovirus plasmid |
| ORF Viral Vector | vGMLP000405 | Human TGFA Lentivirus particle |
| ORF Viral Vector | vGMAP000120 | Human TGFA Adenovirus particle |
Target information
| Target ID | GM-T00033 |
| Target Name | TGF Alpha/TGFA |
|
Gene Group Identifier （Target Gene ID in Homo species) |
7039 |
| Gene ID |
100060423 (Equus caballus), 101094921 (Felis catus), 21802 (Mus musculus), 24827 (Rattus norvegicus) 403431 (Canis lupus familiaris), 540388 (Bos taurus), 613031 (Macaca mulatta), 7039 (Homo sapiens) |
| Gene Symbols & Synonyms | TGFA,Tgfa,wa1,wa-1,TGFAA,RATTGFAA,TGF alpha,TFGA |
| Target Alternative Names | Protransforming growth factor alpha,RATTGFAA,TFGA,TGF Alpha,TGF alpha,TGFA,TGFAA,Tgfa,wa-1,wa1 |
| Uniprot Accession |
P01134,P01135,P48030,P55244
Additional SwissProt Accessions: P48030,P01134,P55244,P01135 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, cancer patients |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, PI3K-Akt signaling pathway, Pathways in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Glioma, Prostate cancer, Non-small cell lung cancer, Hepatocellular carcinoma |
| Gene Ensembl | ENSECAG00000011006, ENSMUSG00000029999, ENSCAFG00845027844, ENSBTAG00000000783, ENSMMUG00000010591, ENSG00000163235 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.