Human PFN1 ORF/cDNA clone-Adenovirus particle (BC002475)

Cat. No.: vGMAP000098

Pre-made Human PFN1/ Adenovirus for PFN1 overexpression in-vitro and in-vivo. The PFN1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PFN1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Profilin 1/PFN1/PFN1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000098 Human PFN1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000098
Gene Name PFN1
Accession Number BC002475
Gene ID 5216
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 423 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCCGGGTGGAACGCCTACATCGACAACCTCATGGCGGACGGGACCTGTCAGGACGCGGCCATCGTGGGCTACAAGGACTCGCCCTCCGTCTGGGCCGCCGTCCCCGGGAAAACGTTCGTCAACATCACGCCAGCTGAGGTGGGTGTCCTGGTTGGCAAAGACCGGTCAAGTTTTTACGTGAATGGGCTGACACTTGGGGGCCAGAAATGTTCGGTGATCCGGGACTCACTGCTGCAGGATGGGGAATTTAGCATGGATCTTCGTACCAAGAGCACCGGTGGGGCCCCCACCTTCAATGTCACTGTCACCAAGACTGACAAGACGCTAGTCCTGCTGATGGGCAAAGAAGGTGTCCACGGTGGTTTGATCAACAAGAAATGTTATGAAATGGCCTCCCACCTTCGGCGTTCCCAGTACTGA
ORF Protein Sequence MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1376-Ab Anti-PFN1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1376-Ag PFN1 protein
    ORF Viral Vector pGMLV002114 Human PFN1 Lentivirus plasmid
    ORF Viral Vector pGMAP000098 Human PFN1 Adenovirus plasmid
    ORF Viral Vector pGMPC001402 Human PFN1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV002114 Human PFN1 Lentivirus particle
    ORF Viral Vector vGMAP000098 Human PFN1 Adenovirus particle


    Target information

    Target ID GM-IP1376
    Target Name Profilin 1/PFN1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5216
    Gene ID 100061295 (Equus caballus), 101091824 (Felis catus), 18643 (Mus musculus), 513895 (Bos taurus)
    5216 (Homo sapiens), 607397 (Canis lupus familiaris), 64303 (Rattus norvegicus), 710753 (Macaca mulatta)
    Gene Symbols & Synonyms PFN1,Pfn1,Pfn,ALS18,profilin-1
    Target Alternative Names Profilin 1, PFN1,Profilin-1,Epididymis tissue protein Li 184a, Profilin I,ALS18
    Uniprot Accession P02584,P07737,P62962,P62963
    Additional SwissProt Accessions: P62962,P02584,P07737,P62963
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Dent disease, Malignant neoplasm of bladder
    Disease from KEGG Rap1 signaling pathway, Regulation of actin cytoskeleton
    Gene Ensembl ENSMUSG00000018293, ENSBTAG00000004915, ENSG00000108518, ENSCAFG00845003501, ENSMMUG00000051787
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.