Human NME1/AWD/GAAD ORF/cDNA clone-Adenovirus particle (BC000293 )
Cat. No.: vGMAP000091
Pre-made Human NME1/AWD/GAAD Adenovirus for NME1 overexpression in-vitro and in-vivo. The NME1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified NME1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
NME1/NM23-H1/NME1/AWD products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP000091 | Human NME1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP000091 |
Gene Name | NME1 |
Accession Number | BC000293 |
Gene ID | 4830 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 459 bp |
Gene Alias | AWD,GAAD,NDPKA,NM23,NM23-H1 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGCCAACTGTGAGCGTACCTTCATTGCGATCAAACCAGATGGGGTCCAGCGGGGTCTTGTGGGAGAGATTATCAAGCGTTTTGAGCAGAAAGGATTCCGCCTTGTTGGTCTGAAATTCATGCAAGCTTCCGAAGATCTTCTCAAGGAACACTACGTTGACCTGAAGGACCGTCCATTCTTTGCCGGCCTGGTGAAATACATGCACTCAGGGCCGGTAGTTGCCATGGTCTGGGAGGGGCTGAATGTGGTGAAGACGGGCCGAGTCATGCTCGGGGAGACCAACCCTGCAGACTCCAAGCCTGGGACCATCCGTGGAGACTTCTGCATACAAGTTGGCAGGAACATTATACATGGCAGTGATTCTGTGGAGAGTGCAGAGAAGGAGATCGGCTTGTGGTTTCACCCTGAGGAACTGGTAGATTACACGAGCTGTGCTCAGAACTGGATCTATGAATGA |
ORF Protein Sequence | MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T42533-Ab | Anti-NDKA/ NM23-H1/ NME1 functional antibody |
Target Antigen | GM-Tg-g-T42533-Ag | NM23-H1/NME1 protein |
ORF Viral Vector | pGMLP000505 | Human NME1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000091 | Human NME1 Adenovirus plasmid |
ORF Viral Vector | vGMLP000505 | Human NME1 Lentivirus particle |
ORF Viral Vector | vGMAP000091 | Human NME1 Adenovirus particle |
Target information
Target ID | GM-T42533 |
Target Name | NME1/NM23-H1 |
Gene Group Identifier (Target Gene ID in Homo species) |
4830 |
Gene ID | 100533956 (Macaca mulatta), 100533966 (Equus caballus), 101088196 (Felis catus), 4830 (Homo sapiens) |
Gene Symbols & Synonyms | NME1,NB,AWD,NBS,GAAD,NDKA,NM23,NDPKA,NDPK-A,NM23-H1 |
Target Alternative Names | AWD,GAAD,Granzyme A-activated DNase (GAAD),Metastasis inhibition factor nm23,NB,NBS,NDK A,NDKA,NDP kinase A,NDPK-A,NDPKA,NM23,NM23-H1,NME1,Nucleoside diphosphate kinase A,Tumor metastatic process-associated protein |
Uniprot Accession |
P15531
Additional SwissProt Accessions: P15531 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | cancer |
Disease from KEGG | Metabolic pathways |
Gene Ensembl | ENSMMUG00000001940, ENSECAG00000059404, ENSG00000239672 |
Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.