Human OSM/MGC20461 ORF/cDNA clone-Adenovirus particle (BC011589)

Cat. No.: vGMAP000088

Pre-made Human OSM/MGC20461 Adenovirus for OSM overexpression in-vitro and in-vivo. The OSM adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified OSM-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to oncostatin M/OSM/OSM/MGC20461 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000088 Human OSM Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000088
Gene Name OSM
Accession Number BC011589
Gene ID 5008
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 759 bp
Gene Alias MGC20461
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGGGTACTGCTCACACAGAGGACGCTGCTCAGTCTGGTCCTTGCACTCCTGTTTCCAAGCATGGCGAGCATGGCGGCTATAGGCAGCTGCTCGAAAGAGTACCGCGTGCTCCTTGGCCAGCTCCAGAAGCAGACAGATCTCATGCAGGACACCAGCAGACTCCTGGACCCCTATATACGTATCCAAGGCCTGGATGTTCCTAAACTGAGAGAGCACTGCAGGGAGCGCCCCGGGGCCTTCCCCAGTGAGGAGACCCTGAGGGGGCTGGGCAGGCGGGGCTTCCTGCAGACCCTCAATGCCACACTGGGCTGCGTCCTGCACAGACTGGCCGACTTAGAGCAGCGCCTCCCCAAGGCCCAGGATTTGGAGAGGTCTGGGCTGAACATCGAGGACTTGGAGAAGCTGCAGATGGCGAGGCCGAACATCCTCGGGCTCAGGAACAACATCTACTGCATGGCCCAGCTGCTGGACAACTCAGACACGGCTGAGCCCACGAAGGCTGGCCGGGGGGCCTCTCAGCCGCCCACCCCCACCCCTGCCTCGGATGCTTTTCAGCGCAAGCTGGAGGGCTGCAGGTTCCTGCATGGCTACCATCGCTTCATGCACTCAGTGGGGCGGGTCTTCAGCAAGTGGGGGGAGAGCCCGAACCGGAGCCGGAGACACAGCCCCCACCAGGCCCTGAGGAAGGGGGTGCGCAGGACCAGACCCTCCAGGAAAGGCAAGAGACTCATGACCAGGGGACAGCTGCCCCGGTAG
ORF Protein Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T19556-Ab Anti-ONCM/ OSM functional antibody
    Target Antigen GM-Tg-g-T19556-Ag OSM protein
    Cytokine cks-Tg-g-GM-T19556 oncostatin M (OSM) protein & antibody
    ORF Viral Vector pGMLP000497 Human OSM Lentivirus plasmid
    ORF Viral Vector pGMAP000088 Human OSM Adenovirus plasmid
    ORF Viral Vector vGMLP000497 Human OSM Lentivirus particle
    ORF Viral Vector vGMAP000088 Human OSM Adenovirus particle


    Target information

    Target ID GM-T19556
    Target Name oncostatin M/OSM
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5008
    Gene ID 100064031 (Equus caballus), 101094379 (Felis catus), 18413 (Mus musculus), 289747 (Rattus norvegicus)
    319086 (Bos taurus), 5008 (Homo sapiens), 611921 (Canis lupus familiaris), 717994 (Macaca mulatta)
    Gene Symbols & Synonyms OSM,Osm,OncoM
    Target Alternative Names OSM,OncoM,Oncostatin-M,Osm,oncostatin M
    Uniprot Accession P13725,P53346,P53347,Q65Z15
    Additional SwissProt Accessions: P53347,Q65Z15,P53346,P13725
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway
    Gene Ensembl ENSECAG00000042076, ENSMUSG00000058755, ENSBTAG00000016163, ENSG00000099985, ENSCAFG00845030908, ENSMMUG00000005545
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.