Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human LAT/LAT1/pp36 ORF/cDNA clone-Adenovirus particle (BC011563)
Cat. No.: vGMAP000058
Pre-made Human LAT/LAT1/pp36 Adenovirus for LAT overexpression in-vitro and in-vivo. The LAT adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified LAT-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
LAT/LAT1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000058 | Human LAT Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000058 |
| Gene Name | LAT |
| Accession Number | BC011563 |
| Gene ID | 27040 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 702 bp |
| Gene Alias | LAT1,pp36 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGAGGAGGCCATCCTGGTCCCCTGCGTGCTGGGGCTCCTGCTGCTGCCCATCCTGGCCATGTTGATGGCACTGTGTGTGCACTGCCACAGACTGCCAGGCTCCTACGACAGCACATCCTCAGATAGTTTGTATCCAAGGGGCATCCAGTTCAAACGGCCTCACACGGTTGCCCCCTGGCCACCTGCCTACCCACCTGTCACCTCCTACCCACCCCTGAGCCAGCCAGACCTGCTCCCCATCCCAAGATCCCCGCAGCCCCTTGGGGGCTCCCACCGGACGCCATCTTCCCGGCGGGATTCTGATGGTGCCAACAGTGTGGCGAGCTACGAGAACGAGGAACCAGCCTGTGAGGATGCGGATGAGGATGAGGACGACTATCACAACCCAGGCTACCTGGTGGTGCTTCCTGACAGCACCCCGGCCACTAGCACTGCTGCCCCATCAGCTCCTGCACTCAGCACCCCTGGCATCCGAGACAGTGCCTTCTCCATGGAGTCCATTGATGATTACGTGAACGTTCCGGAGAGCGGGGAGAGCGCAGAAGCGTCTCTGGATGGCAGCCGGGAGTATGTGAATGTGTCCCAGGAACTGCATCCTGGAGCGGCTAAGACTGAGCCTGCCGCCCTGAGTTCCCAGGAGGCAGAGGAAGTGGAGGAAGAGGGGGCTCCAGATTACGAGAATCTGCAGGAGCTGAACTGA |
| ORF Protein Sequence | MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0722-Ab | Anti-LAT/ IMD521/ pp36 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0722-Ag | LAT VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000495 | Human LAT Lentivirus plasmid |
| ORF Viral Vector | pGMAP000058 | Human LAT Adenovirus plasmid |
| ORF Viral Vector | vGMLP000495 | Human LAT Lentivirus particle |
| ORF Viral Vector | vGMAP000058 | Human LAT Adenovirus particle |
Target information
| Target ID | GM-MP0722 |
| Target Name | LAT |
|
Gene Group Identifier （Target Gene ID in Homo species) |
27040 |
| Gene ID |
100064430 (Equus caballus), 101093319 (Felis catus), 16797 (Mus musculus), 27040 (Homo sapiens) 514735 (Bos taurus), 607947 (Canis lupus familiaris), 704656 (Macaca mulatta), 81511 (Rattus norvegicus) |
| Gene Symbols & Synonyms | LAT,Lat,pp36,p36-38,LAT1,IMD52 |
| Target Alternative Names | 36 kDa phosphotyrosine adapter protein (pp36),IMD52,LAT,LAT1,Lat,Linker for activation of T-cells family member 1,p36-38,pp36 |
| Uniprot Accession |
O43561,O54957,O70601
Additional SwissProt Accessions: O54957,O43561,O70601 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | Ras signaling pathway, Rap1 signaling pathway, NF-kappa B signaling pathway, Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, Yersinia infection, PD-L1 expression and PD-1 checkpoint pathway in cancer |
| Gene Ensembl | ENSECAG00000021184, ENSMUSG00000030742, ENSG00000213658, ENSBTAG00000021249, ENSCAFG00845003673, ENSMMUG00000043332 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.