Human CXCL10/C7/crg-2 ORF/cDNA clone-Adenovirus particle (BC010954)

Cat. No.: vGMAP000053

Pre-made Human CXCL10/C7/crg-2 Adenovirus for CXCL10 overexpression in-vitro and in-vivo. The CXCL10 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CXCL10-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CXCL10/IP-10/CXCL10/C7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000053 Human CXCL10 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000053
Gene Name CXCL10
Accession Number BC010954
Gene ID 3627
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 297 bp
Gene Alias C7,crg-2,gIP-10,IFI10,IP-10,mob-1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAAGGAGTACCTCTCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTTAATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTTGAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAGGCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAA
ORF Protein Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-168 Pre-Made Eldelumab biosimilar, Whole mAb, Anti-CXCL10 Antibody: Anti-C7/IFI10/INP10/IP-10/SCYB10/crg-2/gIP-10/mob-1 therapeutic antibody
    Target Antibody GM-Tg-g-T30635-Ab Anti-CXL10/ CXCL10/ C7 functional antibody
    Target Antigen GM-Tg-g-T30635-Ag CXCL10 protein
    Cytokine cks-Tg-g-GM-T30635 chemokine (C-X-C motif) ligand 10 (CXCL10) protein & antibody
    ORF Viral Vector pGMLP001931 Human CXCL10 Lentivirus plasmid
    ORF Viral Vector pGMAP000053 Human CXCL10 Adenovirus plasmid
    ORF Viral Vector vGMLP001931 Human CXCL10 Lentivirus particle
    ORF Viral Vector vGMAP000053 Human CXCL10 Adenovirus particle


    Target information

    Target ID GM-T30635
    Target Name CXCL10/IP-10
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3627
    Gene ID 100050993 (Equus caballus), 101100131 (Felis catus), 245920 (Rattus norvegicus), 3627 (Homo sapiens)
    478432 (Canis lupus familiaris), 574243 (Macaca mulatta), 615107 (Bos taurus)
    Gene Symbols & Synonyms CXCL10,Cxcl10,IP-10,Scyb10,C7,IFI10,INP10,crg-2,mob-1,SCYB10,gIP-10
    Target Alternative Names 10 kDa interferon gamma-induced protein (Gamma-IP10,C-X-C motif chemokine 10,C7,CXCL10,Cxcl10,IFI10,INP10,IP-10,IP-10),SCYB10,Scyb10,Small-inducible cytokine B10,crg-2,gIP-10,mob-1
    Uniprot Accession P02778,P48973,Q2KIQ8,Q5KSV9,Q8MIZ1
    Additional SwissProt Accessions: P48973,P02778,Q5KSV9,Q8MIZ1,Q2KIQ8
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Breast Cancer, Complications of kidney transplant, Bacterial sepsis of newborn, Acute kidney failure
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Hepatitis C, Influenza A, Epstein-Barr virus infection
    Gene Ensembl ENSG00000169245, ENSCAFG00845029862, ENSMMUG00000020903, ENSBTAG00000001725
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.