Human F8/AHF/DXS1253E ORF/cDNA clone-Adenovirus particle (BC022513)
Cat. No.: vGMAP000016
Pre-made Human F8/AHF/DXS1253E Adenovirus for F8 overexpression in-vitro and in-vivo. The F8 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified F8-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
F8/AHF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000016 | Human F8 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000016 |
| Gene Name | F8 |
| Accession Number | BC022513 |
| Gene ID | 2157 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 651 bp |
| Gene Alias | AHF,DXS1253E,F8B,FVIII,HEMA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGCGGATCCAAGACCCTGGGAAGGTCTTCTTTGGCAATGTGGATTCATCTGGGATAAAACACAATATTTTTAACCCTCCAATTATTGCTCGATACATCCGTTTGCACCCAACTCATTATAGCATTCGCAGCACTCTTCGCATGGAGTTGATGGGCTGTGATTTAAATAGTTGCAGCATGCCATTGGGAATGGAGAGTAAAGCAATATCAGATGCACAGATTACTGCTTCATCCTACTTTACCAATATGTTTGCCACCTGGTCTCCTTCAAAAGCTCGACTTCACCTCCAAGGGAGGAGTAATGCCTGGAGACCTCAGGTGAATAATCCAAAAGAGTGGCTGCAAGTGGACTTCCAGAAGACAATGAAAGTCACAGGAGTAACTACTCAGGGAGTAAAATCTCTGCTTACCAGCATGTATGTGAAGGAGTTCCTCATCTCCAGCAGTCAAGATGGCCATCAGTGGACTCTCTTTTTTCAGAATGGCAAAGTAAAGGTTTTTCAGGGAAATCAAGACTCCTTCACACCTGTGGTGAACTCTCTAGACCCACCGTTACTGACTCGCTACCTTCGAATTCACCCCCAGAGTTGGGTGCACCAGATTGCCCTGAGGATGGAGGTTCTGGGCTGCGAGGCACAGGACCTCTACTGA |
| ORF Protein Sequence | MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T14602 |
| Target Name | F8 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2157 |
| Gene ID |
100063026 (Equus caballus), 100271720 (Bos taurus), 100424151 (Macaca mulatta), 101092751 (Felis catus) 14069 (Mus musculus), 2157 (Homo sapiens), 302470 (Rattus norvegicus), 403875 (Canis lupus familiaris) |
| Gene Symbols & Synonyms | F8,Cf8,Cf-8,FVIII,AHF,F8B,F8C,HEMA,THPH13,DXS1253E |
| Target Alternative Names | AHF,Antihemophilic factor (AHF),Cf-8,Cf8,Coagulation factor VIII,DXS1253E,F8,F8B,F8C,FVIII,HEMA,Procoagulant component,THPH13 |
| Uniprot Accession |
O18806,P00451,Q06194
Additional SwissProt Accessions: Q06194,P00451,O18806 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, INN Index |
| Disease | |
| Disease from KEGG | Complement and coagulation cascades |
| Gene Ensembl | ENSECAG00000015044, ENSBTAG00000010726, ENSMMUG00000010245, ENSMUSG00000031196, ENSG00000185010, ENSCAFG00845030098 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


