Human F8/AHF/DXS1253E ORF/cDNA clone-Adenovirus particle (BC022513)

Cat. No.: vGMAP000016

Pre-made Human F8/AHF/DXS1253E Adenovirus for F8 overexpression in-vitro and in-vivo. The F8 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified F8-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to F8/AHF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000016 Human F8 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000016
Gene Name F8
Accession Number BC022513
Gene ID 2157
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 651 bp
Gene Alias AHF,DXS1253E,F8B,FVIII,HEMA
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCGGATCCAAGACCCTGGGAAGGTCTTCTTTGGCAATGTGGATTCATCTGGGATAAAACACAATATTTTTAACCCTCCAATTATTGCTCGATACATCCGTTTGCACCCAACTCATTATAGCATTCGCAGCACTCTTCGCATGGAGTTGATGGGCTGTGATTTAAATAGTTGCAGCATGCCATTGGGAATGGAGAGTAAAGCAATATCAGATGCACAGATTACTGCTTCATCCTACTTTACCAATATGTTTGCCACCTGGTCTCCTTCAAAAGCTCGACTTCACCTCCAAGGGAGGAGTAATGCCTGGAGACCTCAGGTGAATAATCCAAAAGAGTGGCTGCAAGTGGACTTCCAGAAGACAATGAAAGTCACAGGAGTAACTACTCAGGGAGTAAAATCTCTGCTTACCAGCATGTATGTGAAGGAGTTCCTCATCTCCAGCAGTCAAGATGGCCATCAGTGGACTCTCTTTTTTCAGAATGGCAAAGTAAAGGTTTTTCAGGGAAATCAAGACTCCTTCACACCTGTGGTGAACTCTCTAGACCCACCGTTACTGACTCGCTACCTTCGAATTCACCCCCAGAGTTGGGTGCACCAGATTGCCCTGAGGATGGAGGTTCTGGGCTGCGAGGCACAGGACCTCTACTGA
ORF Protein Sequence MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-934 Pre-Made Omfiloctocog Alfa Biosimilar, Recombinant Protein targeting F8: Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Biosimilar GMP-Bios-INN-809 Pre-Made Efanesoctocog Alfa Biosimilar, Fusion Protein targeting F8 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Biosimilar GMP-Bios-INN-823 Pre-Made Efmoroctocog Alfa Biosimilar, Fusion Protein targeting F8 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Target Antibody GM-Tg-g-T14602-Ab Anti-FA8/ F8/ AHF monoclonal antibody
    Target Antigen GM-Tg-g-T14602-Ag F8 VLP (virus-like particle)
    ORF Viral Vector pGMLP000410 Human F8 Lentivirus plasmid
    ORF Viral Vector pGMAD000412 Human F8 Adenovirus plasmid
    ORF Viral Vector pGMAP000016 Human F8 Adenovirus plasmid
    ORF Viral Vector vGMLP000410 Human F8 Lentivirus particle
    ORF Viral Vector vGMAD000412 Human F8 Adenovirus particle
    ORF Viral Vector vGMAP000016 Human F8 Adenovirus particle


    Target information

    Target ID GM-T14602
    Target Name F8
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2157
    Gene ID 100063026 (Equus caballus), 100271720 (Bos taurus), 100424151 (Macaca mulatta), 101092751 (Felis catus)
    14069 (Mus musculus), 2157 (Homo sapiens), 302470 (Rattus norvegicus), 403875 (Canis lupus familiaris)
    Gene Symbols & Synonyms F8,Cf8,Cf-8,FVIII,AHF,F8B,F8C,HEMA,THPH13,DXS1253E
    Target Alternative Names F8,Coagulation factor VIII,Antihemophilic factor (AHF), Procoagulant component,AHF,F8B,F8C,HEMA,FVIII,THPH13,DXS1253E
    Uniprot Accession O18806,P00451,Q06194
    Additional SwissProt Accessions: Q06194,P00451,O18806
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Complement and coagulation cascades
    Gene Ensembl ENSECAG00000015044, ENSBTAG00000010726, ENSMMUG00000010245, ENSMUSG00000031196, ENSG00000185010, ENSCAFG00845030098
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.