Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human GDNF/ATF/ATF1 ORF/cDNA clone-Adenovirus particle (NM_001190468)
Cat. No.: vGMAP-SPh-284
Pre-made Human GDNF/ATF/ATF1 Adenovirus for GDNF overexpression in-vitro and in-vivo. The GDNF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified GDNF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
GDNF/ATF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP-SPh-284 | Human GDNF Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP-SPh-284 |
| Gene Name | GDNF |
| Accession Number | NM_001190468 |
| Gene ID | 2668 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 687 bp |
| Gene Alias | ATF,ATF1,ATF2,HFB1-GDNF,HSCR3 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGTCTTTGCCTAACAGCAATGGTGCCGCCGCCGGACGGGACTTTAAGATGAAGTTATGGGATGTCGTGGCTGTCTGCCTGGTGCTGCTCCACACCGCGTCCGCCTTCCCGCTGCCCGCCGGTAAGAGGCCTCCCGAGGCGCCCGCCGAAGACCGCTCCCTCGGCCGCCGCCGCGCGCCCTTCGCGCTGAGCAGTGACTCAAATATGCCAGAGGATTATCCTGATCAGTTCGATGATGTCATGGATTTTATTCAAGCCACCATTAAAAGACTGAAAAGGTCACCAGATAAACAAATGGCAGTGCTTCCTAGAAGAGAGCGGAATCGGCAGGCTGCAGCTGCCAACCCAGAGAATTCCAGAGGAAAAGGTCGGAGAGGCCAGAGGGGCAAAAACCGGGGTTGTGTCTTAACTGCAATACATTTAAATGTCACTGACTTGGGTCTGGGCTATGAAACCAAGGAGGAACTGATTTTTAGGTACTGCAGCGGCTCTTGCGATGCAGCTGAGACAACGTACGACAAAATATTGAAAAACTTATCCAGAAATAGAAGGCTGGTGAGTGACAAAGTAGGGCAGGCATGTTGCAGACCCATCGCCTTTGATGATGACCTGTCGTTTTTAGATGATAACCTGGTTTACCATATTCTAAGAAAGCATTCCGCTAAAAGGTGTGGATGTATCTGA |
| ORF Protein Sequence | MQSLPNSNGAAAGRDFKMKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T79160-Ab | Anti-GDNF/ ATF/ ATF1 functional antibody |
| Target Antigen | GM-Tg-g-T79160-Ag | GDNF protein |
| Cytokine | cks-Tg-g-GM-T79160 | glial cell derived neurotrophic factor (GDNF) protein & antibody |
| ORF Viral Vector | pGMLP002678 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV000366 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV000484 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV001834 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-284 | Human GDNF Adenovirus plasmid |
| ORF Viral Vector | vGMLP002678 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV000366 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV000484 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV001834 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-284 | Human GDNF Adenovirus particle |
Target information
| Target ID | GM-T79160 |
| Target Name | GDNF |
|
Gene Group Identifier （Target Gene ID in Homo species) |
2668 |
| Gene ID |
100067053 (Equus caballus), 101097871 (Felis catus), 119871563 (Canis lupus familiaris), 14573 (Mus musculus) 25453 (Rattus norvegicus), 2668 (Homo sapiens), 386587 (Bos taurus), 706345 (Macaca mulatta) |
| Gene Symbols & Synonyms | GDNF,Gdnf,ATF,gndf,ATF1,ATF2,HSCR3,HFB1-GDNF |
| Target Alternative Names | ATF,ATF1,ATF2,Astrocyte-derived trophic factor (ATF),GDNF,Gdnf,Glial cell line-derived neurotrophic factor,HFB1-GDNF,HSCR3,gndf,hGDNF |
| Uniprot Accession |
P39905,P48540,Q07731
Additional SwissProt Accessions: P48540,Q07731,P39905 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer, Lung Cancer |
| Disease from KEGG | Calcium signaling pathway |
| Gene Ensembl | ENSECAG00000037655, ENSCAFG00845003744, ENSMUSG00000022144, ENSG00000168621, ENSBTAG00000005176, ENSMMUG00000018963 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.