Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IL36RN/FIL1/FIL1(DELTA) ORF/cDNA clone-Adenovirus particle (NM_012275)
Cat. No.: vGMAP-IL-125
Pre-made Human IL36RN/FIL1/FIL1(DELTA) Adenovirus for IL36RN overexpression in-vitro and in-vivo. The IL36RN adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL36RN-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
IL-36RN/IL36RN/IL36RN/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP-IL-125 | Human IL36RN Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP-IL-125 |
| Gene Name | IL36RN |
| Accession Number | NM_012275 |
| Gene ID | 26525 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 468 bp |
| Gene Alias | FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGTCCTGAGTGGGGCGCTGTGCTTCCGAATGAAGGACTCGGCATTGAAGGTGCTTTATCTGCATAATAACCAGCTTCTAGCTGGAGGGCTGCATGCAGGGAAGGTCATTAAAGGTGAAGAGATCAGCGTGGTCCCCAATCGGTGGCTGGATGCCAGCCTGTCCCCCGTCATCCTGGGTGTCCAGGGTGGAAGCCAGTGCCTGTCATGTGGGGTGGGGCAGGAGCCGACTCTAACACTAGAGCCAGTGAACATCATGGAGCTCTATCTTGGTGCCAAGGAATCCAAGAGCTTCACCTTCTACCGGCGGGACATGGGGCTCACCTCCAGCTTCGAGTCGGCTGCCTACCCGGGCTGGTTCCTGTGCACGGTGCCTGAAGCCGATCAGCCTGTCAGACTCACCCAGCTTCCCGAGAATGGTGGCTGGAATGCCCCCATCACAGACTTCTACTTCCAGCAGTGTGACTAG |
| ORF Protein Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-532 | Pre-Made Spesolimab biosimilar, Whole mAb, Anti-IL36RN/IL-36R Antibody: Anti-FIL1/FIL1(DELTA)/FIL1D/IL1F5/IL1HY1/IL1L1/IL1RP3/IL36RA/PSORP/PSORS14 therapeutic antibody |
| Target Antibody | GM-Tg-g-SE0627-Ab | Anti-I36RA/ IL36RN/ FIL1 functional antibody |
| Target Antigen | GM-Tg-g-SE0627-Ag | IL36RN protein |
| Cytokine | cks-Tg-g-GM-SE0627 | interleukin 36 receptor antagonist (IL36RN) protein & antibody |
| ORF Viral Vector | pGMLP004790 | Human IL36RN Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-042 | Human IL36RN Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-125 | Human IL36RN Adenovirus plasmid |
| ORF Viral Vector | vGMLP004790 | Human IL36RN Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-042 | Human IL36RN Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-125 | Human IL36RN Adenovirus particle |
Target information
| Target ID | GM-SE0627 |
| Target Name | IL-36RN/IL36RN |
|
Gene Group Identifier （Target Gene ID in Homo species) |
26525 |
| Gene ID |
100065154 (Equus caballus), 26525 (Homo sapiens), 311783 (Rattus norvegicus), 518514 (Bos taurus) 54450 (Mus musculus), 611869 (Canis lupus familiaris), 705268 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL36RN,Il36rn,FIL1,FIL1D,IL1F5,IL1L1,PSORP,IL1HY1,IL1RP3,IL36RA,IL-36Ra,PSORS14,FIL1(DELTA),Il1f5,If36rn,Il-1h3,Il1hy1,Fil1delta |
| Target Alternative Names | FIL1,FIL1 delta,FIL1(DELTA),FIL1D,Fil1delta,IL-1-related protein 3 (IL-1RP3),IL-36RN,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,IL36RN,If36rn,Il-1h3,Il1f5,Il1hy1,Il36rn,Interleukin-1 HY1 (IL-1HY1),Interleukin-1 delta (IL-1 delta),Interleukin-1 family member 5 (IL-1F5),Interleukin-1 receptor antagonist homolog 1 (IL-1ra homolog 1),Interleukin-1-like protein 1 (IL-1L1),Interleukin-36 receptor antagonist protein,PSORP,PSORS14 |
| Uniprot Accession |
Q9QYY1,Q9UBH0
Additional SwissProt Accessions: Q9UBH0,Q9QYY1 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000020486, ENSG00000136695, ENSBTAG00000039839, ENSMUSG00000026983, ENSCAFG00845011829, ENSMMUG00000061691 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.