Human IL36G/IL-1F9/IL-1H1 ORF/cDNA clone-Adenovirus particle (NM_019618)

Cat. No.: vGMAP-IL-124

Pre-made Human IL36G/IL-1F9/IL-1H1 Adenovirus for IL36G overexpression in-vitro and in-vivo. The IL36G adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL36G-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL-36 Gamma/IL36G/IL36G/IL-1F9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-124 Human IL36G Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-124
Gene Name IL36G
Accession Number NM_019618
Gene ID 56300
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 510 bp
Gene Alias IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGAGGCACTCCAGGAGACGCTGATGGTGGAGGAAGGGCCGTCTATCAATCAATGTGTAAACCTATTACTGGGACTATTAATGATTTGAATCAGCAAGTGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGTGTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCTTGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAATGTGTTTGTATTGTGAGAAGGTTGGAGAACAGCCCACATTGCAGCTAAAAGAGCAGAAGATCATGGATCTGTATGGCCAACCCGAGCCCGTGAAACCCTTCCTTTTCTACCGTGCCAAGACTGGTAGGACCTCCACCCTTGAGTCTGTGGCCTTCCCGGACTGGTTCATTGCCTCCTCCAAGAGAGACCAGCCCATCATTCTGACTTCAGAACTTGGGAAGTCATACAACACTGCCTTTGAATTAAATATAAATGACTGA
ORF Protein Sequence MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72514-Ab Anti-IL36G/ IL-1F9/ IL-1H1 monoclonal antibody
    Target Antigen GM-Tg-g-T72514-Ag IL36G VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T72514 interleukin 36, gamma (IL36G) protein & antibody
    ORF Viral Vector pGMLP003211 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-041 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-124 Human IL36G Adenovirus plasmid
    ORF Viral Vector vGMLP003211 Human IL36G Lentivirus particle
    ORF Viral Vector vGMLP-IL-041 Human IL36G Lentivirus particle
    ORF Viral Vector vGMAP-IL-124 Human IL36G Adenovirus particle


    Target information

    Target ID GM-T72514
    Target Name IL-36 Gamma/IL36G
    Gene Group Identifier
    (Target Gene ID in Homo species)
    56300
    Gene ID 100065031 (Equus caballus), 100686137 (Canis lupus familiaris), 101081377 (Felis catus), 215257 (Mus musculus)
    499744 (Rattus norvegicus), 56300 (Homo sapiens), 615762 (Bos taurus), 700822 (Macaca mulatta)
    Gene Symbols & Synonyms IL36G,Il36g,If36g,Il1f9,IL-36gamma,RGD1563019,IL1E,IL1F9,IL1H1,IL-1F9,IL-1H1,IL1RP2,IL-1RP2
    Target Alternative Names IL-1-related protein 2 (IL-1RP2),IL-1F9,IL-1H1,IL-1RP2,IL-36 Gamma,IL-36gamma,IL1E,IL1F9,IL1H1,IL1RP2,IL36G,If36g,Il1f9,Il36g,Interleukin-1 epsilon (IL-1 epsilon),Interleukin-1 family member 9 (IL-1F9),Interleukin-1 homolog 1 (IL-1H1),Interleukin-36 gamma,RGD1563019
    Uniprot Accession Q8R460,Q9NZH8
    Additional SwissProt Accessions: Q8R460,Q9NZH8
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000059103, ENSCAFG00845011516, ENSMUSG00000044103, ENSG00000136688, ENSBTAG00000002085, ENSMMUG00000062948
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.