Human IL36A/FIL1/FIL1(EPSILON) ORF/cDNA clone-Adenovirus particle (NM_014440)

Cat. No.: vGMAP-IL-122

Pre-made Human IL36A/FIL1/FIL1(EPSILON) Adenovirus for IL36A overexpression in-vitro and in-vivo. The IL36A adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL36A-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL-1F6/IL-36 Alpha/IL36A/IL36A/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-122 Human IL36A Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-122
Gene Name IL36A
Accession Number NM_014440
Gene ID 27179
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 477 bp
Gene Alias FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAAAAAGCATTGAAAATTGACACACCTCAGCAGGGGAGCATTCAGGATATCAATCATCGGGTGTGGGTTCTTCAGGACCAGACGCTCATAGCAGTCCCGAGGAAGGACCGTATGTCTCCAGTCACTATTGCCTTAATCTCATGCCGACATGTGGAGACCCTTGAGAAAGACAGAGGGAACCCCATCTACCTGGGCCTGAATGGACTCAATCTCTGCCTGATGTGTGCTAAAGTCGGGGACCAGCCCACACTGCAGCTGAAGGAAAAGGATATAATGGATTTGTACAACCAACCCGAGCCTGTGAAGTCCTTTCTCTTCTACCACAGCCAGAGTGGCAGGAACTCCACCTTCGAGTCTGTGGCTTTCCCTGGCTGGTTCATCGCTGTCAGCTCTGAAGGAGGCTGTCCTCTCATCCTTACCCAAGAACTGGGGAAAGCCAACACTACTGACTTTGGGTTAACTATGCTGTTTTAA
ORF Protein Sequence MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1029-Ab Anti-IL36A/ FIL1/ FIL1(EPSILON) functional antibody
    Target Antigen GM-Tg-g-SE1029-Ag IL36A protein
    Cytokine cks-Tg-g-GM-SE1029 IL-1 F6 (IL36A) protein & antibody
    ORF Viral Vector pGMLP-IL-039 Human IL36A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-122 Human IL36A Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-039 Human IL36A Lentivirus particle
    ORF Viral Vector vGMAP-IL-122 Human IL36A Adenovirus particle


    Target information

    Target ID GM-SE1029
    Target Name IL-1F6/IL-36 Alpha/IL36A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		27179
    Gene ID 27179 (Homo sapiens), 296541 (Rattus norvegicus), 705136 (Macaca mulatta)
    Gene Symbols & Synonyms IL36A,Il36a,FIL1,FIL1E,IL1F6,IL-1F6,IL1(EPSILON),FIL1(EPSILON),Il1f6
    Target Alternative Names IL-1F6, IL-36 Alpha, IL36A,Interleukin-36 alpha,FIL1 epsilon, Interleukin-1 epsilon (IL-1 epsilon), Interleukin-1 family member 6 (IL-1F6),FIL1,FIL1E,IL1F6,IL-1F6,IL1(EPSILON),FIL1(EPSILON)
    Uniprot Accession Q9UHA7
    Additional SwissProt Accessions: Q9UHA7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSG00000136694, ENSMMUG00000000988
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.