Human IL12B/CLMF/CLMF2 ORF/cDNA clone-Adenovirus particle (NM_002187)

Cat. No.: vGMAP-IL-099

Pre-made Human IL12B/CLMF/CLMF2 Adenovirus for IL12B overexpression in-vitro and in-vivo. The IL12B adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL12B-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL-12/IL-23 p40/IL12B/IL12B/CLMF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-099 Human IL12B Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-099
Gene Name IL12B
Accession Number NM_002187
Gene ID 3593
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 987 bp
Gene Alias CLMF,CLMF2,IL-12B,IMD28,IMD29,NKSF,NKSF2
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTGTCACCAGCAGTTGGTCATCTCTTGGTTTTCCCTGGTTTTTCTGGCATCTCCCCTCGTGGCCATATGGGAACTGAAGAAAGATGTTTATGTCGTAGAATTGGATTGGTATCCGGATGCCCCTGGAGAAATGGTGGTCCTCACCTGTGACACCCCTGAAGAAGATGGTATCACCTGGACCTTGGACCAGAGCAGTGAGGTCTTAGGCTCTGGCAAAACCCTGACCATCCAAGTCAAAGAGTTTGGAGATGCTGGCCAGTACACCTGTCACAAAGGAGGCGAGGTTCTAAGCCATTCGCTCCTGCTGCTTCACAAAAAGGAAGATGGAATTTGGTCCACTGATATTTTAAAGGACCAGAAAGAACCCAAAAATAAGACCTTTCTAAGATGCGAGGCCAAGAATTATTCTGGACGTTTCACCTGCTGGTGGCTGACGACAATCAGTACTGATTTGACATTCAGTGTCAAAAGCAGCAGAGGCTCTTCTGACCCCCAAGGGGTGACGTGCGGAGCTGCTACACTCTCTGCAGAGAGAGTCAGAGGGGACAACAAGGAGTATGAGTACTCAGTGGAGTGCCAGGAGGACAGTGCCTGCCCAGCTGCTGAGGAGAGTCTGCCCATTGAGGTCATGGTGGATGCCGTTCACAAGCTCAAGTATGAAAACTACACCAGCAGCTTCTTCATCAGGGACATCATCAAACCTGACCCACCCAAGAACTTGCAGCTGAAGCCATTAAAGAATTCTCGGCAGGTGGAGGTCAGCTGGGAGTACCCTGACACCTGGAGTACTCCACATTCCTACTTCTCCCTGACATTCTGCGTTCAGGTCCAGGGCAAGAGCAAGAGAGAAAAGAAAGATAGAGTCTTCACGGACAAGACCTCAGCCACGGTCATCTGCCGCAAAAATGCCAGCATTAGCGTGCGGGCCCAGGACCGCTACTATAGCTCATCTTGGAGCGAATGGGCATCTGTGCCCTGCAGTTAG
ORF Protein Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-605 Pre-Made Ustekinumab biosimilar, Whole mAb, Anti-IL12B Antibody: Anti-CLMF/CLMF2/IL-12B/IMD28/IMD29/NKSF/NKSF2 therapeutic antibody
    Biosimilar GMP-Bios-ab-081 Pre-Made Briakinumab biosimilar, Whole mAb, Anti-IL12B Antibody: Anti-CLMF/CLMF2/IL-12B/IMD28/IMD29/NKSF/NKSF2 therapeutic antibody
    Biosimilar GMP-Bios-ab-162 Pre-Made Ebdarokimab biosimilar, Whole mAb, Anti-IL12B Antibody: Anti-CLMF/CLMF2/IL-12B/IMD28/IMD29/NKSF/NKSF2 therapeutic antibody
    Target Antibody GM-Tg-g-T95385-Ab Anti-IL12B/ CLMF/ CLMF2 functional antibody
    Target Antigen GM-Tg-g-T95385-Ag IL12B protein
    Cytokine cks-Tg-g-GM-T95385 Interleukin 12b (IL12B) protein & antibody
    ORF Viral Vector pGMLP000740 Human IL12B Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-016 Human IL12B Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-099 Human IL12B Adenovirus plasmid
    ORF Viral Vector vGMLP000740 Human IL12B Lentivirus particle
    ORF Viral Vector vGMLP-IL-016 Human IL12B Lentivirus particle
    ORF Viral Vector vGMAP-IL-099 Human IL12B Adenovirus particle


    Target information

    Target ID GM-T95385
    Target Name IL-12/IL-23 p40/IL12B
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3593
    Gene ID 100034222 (Equus caballus), 16160 (Mus musculus), 281857 (Bos taurus), 3593 (Homo sapiens)
    403976 (Canis lupus familiaris), 64546 (Rattus norvegicus), 694747 (Macaca mulatta), 768273 (Felis catus)
    Gene Symbols & Synonyms IL12B,Il12b,p40,Il-12b,Il12p40,Il-12p40,IL12p40,CLMF,NKSF,CLMF2,IMD28,IMD29,NKSF2,IL-12B,Il12,IL-12.p40
    Target Alternative Names CLMF,CLMF2,Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40),IL-12,IL-12 subunit p40,IL-12.p40,IL-12B,IL-23 p40,IL12B,IL12p40,IMD28,IMD29,Il-12b,Il-12p40,Il12,Il12b,Il12p40,Interleukin-12 subunit beta,NK cell stimulatory factor chain 2 (NKSF2),NKSF,NKSF2,p40
    Uniprot Accession O02744,P29460,P43432,P46282,P48095,Q28268,Q9XSQ5
    Additional SwissProt Accessions: Q9XSQ5,P43432,P46282,P29460,Q28268,P48095,O02744
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th1 and Th2 cell differentiation, Alcoholic liver disease, Type I diabetes mellitus, Pertussis, Legionellosis, Leishmaniasis, Chagas disease, African trypanosomiasis, Toxoplasmosis, Amoebiasis, Tuberculosis, Measles, Influenza A, Pathways in cancer, Proteoglycans in cancer, Inflammatory bowel disease, Allograft rejection, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000012803, ENSMUSG00000004296, ENSBTAG00000004741, ENSG00000113302, ENSCAFG00845001277, ENSMMUG00000021701
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.