Human IL12A/CLMF/IL-12A ORF/cDNA clone-Adenovirus particle (NM_000882)

Cat. No.: vGMAP-IL-098

Pre-made Human IL12A/CLMF/IL-12A Adenovirus for IL12A overexpression in-vitro and in-vivo. The IL12A adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL12A-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL-12/IL12A/IL12A/CLMF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-098 Human IL12A Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-098
Gene Name IL12A
Accession Number NM_000882
Gene ID 3592
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 762 bp
Gene Alias CLMF,IL-12A,NFSK,NKSF1,P35
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTGGCCCCCTGGGTCAGCCTCCCAGCCACCGCCCTCACCTGCCGCGGCCACAGGTCTGCATCCAGCGGCTCGCCCTGTGTCCCTGCAGTGCCGGCTCAGCATGTGTCCAGCGCGCAGCCTCCTCCTTGTGGCTACCCTGGTCCTCCTGGACCACCTCAGTTTGGCCAGAAACCTCCCCGTGGCCACTCCAGACCCAGGAATGTTCCCATGCCTTCACCACTCCCAAAACCTGCTGAGGGCCGTCAGCAACATGCTCCAGAAGGCCAGACAAACTCTAGAATTTTACCCTTGCACTTCTGAAGAGATTGATCATGAAGATATCACAAAAGATAAAACCAGCACAGTGGAGGCCTGTTTACCATTGGAATTAACCAAGAATGAGAGTTGCCTAAATTCCAGAGAGACCTCTTTCATAACTAATGGGAGTTGCCTGGCCTCCAGAAAGACCTCTTTTATGATGGCCCTGTGCCTTAGTAGTATTTATGAAGACTTGAAGATGTACCAGGTGGAGTTCAAGACCATGAATGCAAAGCTTCTGATGGATCCTAAGAGGCAGATCTTTCTAGATCAAAACATGCTGGCAGTTATTGATGAGCTGATGCAGGCCCTGAATTTCAACAGTGAGACTGTGCCACAAAAATCCTCCCTTGAAGAACCGGATTTTTATAAAACTAAAATCAAGCTCTGCATACTTCTTCATGCTTTCAGAATTCGGGCAGTGACTATTGATAGAGTGATGAGCTATCTGAATGCTTCCTAA
ORF Protein Sequence MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T13251-Ab Anti-IL12A/ CLMF/ IL-12A functional antibody
    Target Antigen GM-Tg-g-T13251-Ag IL12A protein
    Cytokine cks-Tg-g-GM-T13251 IL-12 p70 (IL12A) protein & antibody
    ORF Viral Vector pGMLV000443 Human IL12A Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-015 Human IL12A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-098 Human IL12A Adenovirus plasmid
    ORF Viral Vector vGMLV000443 Human IL12A Lentivirus particle
    ORF Viral Vector vGMLP-IL-015 Human IL12A Lentivirus particle
    ORF Viral Vector vGMAP-IL-098 Human IL12A Adenovirus particle


    Target information

    Target ID GM-T13251
    Target Name IL-12/IL12A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3592
    Gene ID 100034215 (Equus caballus), 16159 (Mus musculus), 281856 (Bos taurus), 3592 (Homo sapiens)
    403977 (Canis lupus familiaris), 493741 (Felis catus), 703205 (Macaca mulatta), 84405 (Rattus norvegicus)
    Gene Symbols & Synonyms IL12A,Il12a,IL-12A,p35,Ll12a,Il-12a,IL-12p35,IL12p35,Il-12 p35,P35,CLMF,NFSK,NKSF1,CLMF p35
    Target Alternative Names IL-12, IL12A,Interleukin-12 subunit alpha,IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1),P35,CLMF,NFSK,NKSF1,IL-12A
    Uniprot Accession O02743,P29459,P43431,P48091,P54349,Q28267,Q9R103,Q9XSQ6
    Additional SwissProt Accessions: Q9XSQ6,P43431,P54349,P29459,Q28267,O02743,P48091,Q9R103
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, malignant glioma
    Disease from KEGG Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th1 and Th2 cell differentiation, Alcoholic liver disease, Type I diabetes mellitus, Pertussis, Legionellosis, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Measles, Influenza A, Pathways in cancer, Inflammatory bowel disease, Allograft rejection, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000024671, ENSMUSG00000027776, ENSBTAG00000015150, ENSG00000168811, ENSCAFG00845026803, ENSMMUG00000023084
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.