Human MDK/ARAP/MK ORF/cDNA clone-Adenovirus particle (NM_001012334.2)

Cat. No.: vGMAD001596

Pre-made Human MDK/ARAP/MK Adenovirus for MDK overexpression in-vitro and in-vivo. The MDK adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified MDK-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Midkine/MDK/MDK/ARAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD001596 Human MDK Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD001596
Gene Name MDK
Accession Number NM_001012334.2
Gene ID 4192
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 432 bp
Gene Alias ARAP,MK,NEGF2
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 6xHis (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGCAGCACCGAGGCTTCCTCCTCCTCACCCTCCTCGCCCTGCTGGCGCTCACCTCCGCGGTCGCCAAAAAGAAAGATAAGGTGAAGAAGGGCGGCCCGGGGAGCGAGTGCGCTGAGTGGGCCTGGGGGCCCTGCACCCCCAGCAGCAAGGATTGCGGCGTGGGTTTCCGCGAGGGCACCTGCGGGGCCCAGACCCAGCGCATCCGGTGCAGGGTGCCCTGCAACTGGAAGAAGGAGTTTGGAGCCGACTGCAAGTACAAGTTTGAGAACTGGGGTGCGTGTGATGGGGGCACAGGCACCAAAGTCCGCCAAGGCACCCTGAAGAAGGCGCGCTACAATGCTCAGTGCCAGGAGACCATCCGCGTCACCAAGCCCTGCACCCCCAAGACCAAAGCAAAGGCCAAAGCCAAGAAAGGGAAGGGAAAGGACTAG
ORF Protein Sequence MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T03878-Ab Anti-MK/ Midkine/ MDK functional antibody
    Target Antigen GM-Tg-g-T03878-Ag Midkine/MDK protein
    ORF Viral Vector pGMLP000499 Human MDK Lentivirus plasmid
    ORF Viral Vector pGMAD001596 Human MDK Adenovirus plasmid
    ORF Viral Vector pGMAP000446 Human MDK Adenovirus plasmid
    ORF Viral Vector pGMAP000465 Human MDK Adenovirus plasmid
    ORF Viral Vector vGMLP000499 Human MDK Lentivirus particle
    ORF Viral Vector vGMAD001596 Human MDK Adenovirus particle
    ORF Viral Vector vGMAP000446 Human MDK Adenovirus particle
    ORF Viral Vector vGMAP000465 Human MDK Adenovirus particle


    Target information

    Target ID GM-T03878
    Target Name Midkine/MDK
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4192
    Gene ID 100147284 (Equus caballus), 101087941 (Felis catus), 119864230 (Canis lupus familiaris), 17242 (Mus musculus)
    280852 (Bos taurus), 4192 (Homo sapiens), 714591 (Macaca mulatta), 81517 (Rattus norvegicus)
    Gene Symbols & Synonyms MDK,Mdk,MK,Mek,ARAP,NEGF2
    Target Alternative Names Midkine, MDK,Midkine,MK,Amphiregulin-associated protein (ARAP), Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein,MK,ARAP,NEGF2
    Uniprot Accession P12025,P21741,Q9R1S9
    Additional SwissProt Accessions: P12025,P21741,Q9R1S9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Lung Cancer, Malignant neoplasm of bladder, Urinary bladder urothelial carcinoma, breast cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000029071, ENSCAFG00845028187, ENSMUSG00000027239, ENSBTAG00000007740, ENSG00000110492, ENSMMUG00000038138
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.