Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human HSPB1/CMT2F/HEL-S-102 ORF/cDNA clone-Adenovirus particle (NM_001540.5)
Cat. No.: vGMAD001513
Pre-made Human HSPB1/CMT2F/HEL-S-102 Adenovirus for HSPB1 overexpression in-vitro and in-vivo. The HSPB1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified HSPB1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
HSP27/HSPB1/HSP20/HSPB1/CMT2F products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD001513 | Human HSPB1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD001513 |
| Gene Name | HSPB1 |
| Accession Number | NM_001540.5 |
| Gene ID | 3315 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 618 bp |
| Gene Alias | CMT2F,HEL-S-102,HMN2B,HS.76067,Hsp25,HSP27,HSP28,SRP27 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 6xHis (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGACCGAGCGCCGCGTCCCCTTCTCGCTCCTGCGGGGCCCCAGCTGGGACCCCTTCCGCGACTGGTACCCGCATAGCCGCCTCTTCGACCAGGCCTTCGGGCTGCCCCGGCTGCCGGAGGAGTGGTCGCAGTGGTTAGGCGGCAGCAGCTGGCCAGGCTACGTGCGCCCCCTGCCCCCCGCCGCCATCGAGAGCCCCGCAGTGGCCGCGCCCGCCTACAGCCGCGCGCTCAGCCGGCAACTCAGCAGCGGGGTCTCGGAGATCCGGCACACTGCGGACCGCTGGCGCGTGTCCCTGGATGTCAACCACTTCGCCCCGGACGAGCTGACGGTCAAGACCAAGGATGGCGTGGTGGAGATCACCGGCAAGCACGAGGAGCGGCAGGACGAGCATGGCTACATCTCCCGGTGCTTCACGCGGAAATACACGCTGCCCCCCGGTGTGGACCCCACCCAAGTTTCCTCCTCCCTGTCCCCTGAGGGCACACTGACCGTGGAGGCCCCCATGCCCAAGCTAGCCACGCAGTCCAACGAGATCACCATCCCAGTCACCTTCGAGTCGCGGGCCCAGCTTGGGGGCCCAGAAGCTGCAAAATCCGATGAGACTGCCGCCAAGTAA |
| ORF Protein Sequence | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T39921-Ab | Anti-HSPB1/ HSP20/ CMT2F monoclonal antibody |
| Target Antigen | GM-Tg-g-T39921-Ag | HSP20/HSPB1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV000322 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000837 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001124 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001513 | Human HSPB1 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000322 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMLV000837 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMLV001124 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMAD001513 | Human HSPB1 Adenovirus particle |
Target information
| Target ID | GM-T39921 |
| Target Name | HSP27/HSPB1/HSP20 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
3315 |
| Gene ID |
100059763 (Equus caballus), 101084411 (Felis catus), 15507 (Mus musculus), 24471 (Rattus norvegicus) 3315 (Homo sapiens), 403979 (Canis lupus familiaris), 516099 (Bos taurus), 715615 (Macaca mulatta) |
| Gene Symbols & Synonyms | HSPB1,Hspb1,27kDa,Hsp25,Hsp27,CMT2F,HMN2B,HMND3,HSP27,HSP28,SRP27,HS.76067,HEL-S-102,HSP 27 |
| Target Alternative Names | HSP27, HSPB1, HSP20,Heat shock protein beta-1,HspB1,28 kDa heat shock protein, Estrogen-regulated 24 kDa protein, Heat shock 27 kDa protein (HSP 27), Heat shock protein family B member 1, Stress-responsive protein 27 (SRP27),CMT2F,HMN2B,HMND3,HSP27,HSP28,Hsp25,SRP27,HS.76067,HEL-S-102 |
| Uniprot Accession |
P04792,P14602,P42929,P42930,Q3T149
Additional SwissProt Accessions: P14602,P42930,P04792,P42929,Q3T149 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer, Congenital occlusion of ureteropelvic junction, Renal clear cell carcinoma |
| Disease from KEGG | MAPK signaling pathway, Amoebiasis |
| Gene Ensembl | ENSECAG00000020463, ENSMUSG00000004951, ENSG00000106211, ENSCAFG00845004436, ENSBTAG00000011969, ENSMMUG00000056744 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.