Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human AGR2/AG-2/AG2 ORF/cDNA clone-Adenovirus particle (NM_006408.4)
Cat. No.: vGMAD001490
Pre-made Human AGR2/AG-2/AG2 Adenovirus for AGR2 overexpression in-vitro and in-vivo. The AGR2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified AGR2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
AGR2/AG-2/AGR2/AG-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD001490 | Human AGR2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD001490 |
| Gene Name | AGR2 |
| Accession Number | NM_006408.4 |
| Gene ID | 10551 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 528 bp |
| Gene Alias | AG-2,AG2,GOB-4,HAG-2,HEL-S-116,HPC8,PDIA17,RIFTD,XAG-2 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCACAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGGTTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAACCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGATATCACTGGAAGATATTCAAATCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACATGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTGTAA |
| ORF Protein Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T34352-Ab | Anti-AGR2/ AG-2/ AG2 functional antibody |
| Target Antigen | GM-Tg-g-T34352-Ag | AG-2/AGR2 protein |
| ORF Viral Vector | pGMLV001303 | Human AGR2 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001490 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000150 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV001303 | Human AGR2 Lentivirus particle |
| ORF Viral Vector | vGMAD001490 | Human AGR2 Adenovirus particle |
| ORF Viral Vector | vGMAP000150 | Human AGR2 Adenovirus particle |
Target information
| Target ID | GM-T34352 |
| Target Name | AGR2/AG-2 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
10551 |
| Gene ID |
100053075 (Equus caballus), 101084694 (Felis catus), 10551 (Homo sapiens), 23795 (Mus musculus) 298961 (Rattus norvegicus), 415112 (Bos taurus), 482333 (Canis lupus familiaris), 709127 (Macaca mulatta) |
| Gene Symbols & Synonyms | AGR2,Agr2,AG2,AG-2,HPC8,GOB-4,HAG-2,RIFTD,XAG-2,PDIA17,HEL-S-116,Agr2h,Gob-4,mAG-2 |
| Target Alternative Names | AG-2,AG2,AGR2,Agr2,Agr2h,Anterior gradient protein 2 homolog,GOB-4,Gob-4,HAG-2,HEL-S-116,HPC8,PDIA17,RIFTD,Secreted cement gland protein XAG-2 homolog,XAG-2,hAG-2,mAG-2 |
| Uniprot Accession |
O88312,O95994
Additional SwissProt Accessions: O95994,O88312 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer, Malignant neoplasm of prostate |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000043283, ENSG00000106541, ENSMUSG00000020581, ENSBTAG00000024406, ENSCAFG00845005787, ENSMMUG00000017050 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.