Human ITLN1/hIntL/HL-1 ORF/cDNA clone-Adenovirus particle (NM_017625)
Cat. No.: vGMAD001119
Pre-made Human ITLN1/hIntL/HL-1 Adenovirus for ITLN1 overexpression in-vitro and in-vivo. The ITLN1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ITLN1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
ITLN1/hIntL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD001119 | Human ITLN1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD001119 |
| Gene Name | ITLN1 |
| Accession Number | NM_017625 |
| Gene ID | 55600 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 942 bp |
| Gene Alias | hIntL,HL-1,HL1,INTL,ITLN,LFR,omentin |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAACCAACTCAGCTTCCTGCTGTTTCTCATAGCGACCACCAGAGGATGGAGTACAGATGAGGCTAATACTTACTTCAAGGAATGGACCTGTTCTTCGTCTCCATCTCTGCCCAGAAGCTGCAAGGAAATCAAAGACGAATGTCCTAGTGCATTTGATGGCCTGTATTTTCTCCGCACTGAGAATGGTGTTATCTACCAGACCTTCTGTGACATGACCTCTGGGGGTGGCGGCTGGACCCTGGTGGCCAGCGTGCACGAGAATGACATGCGTGGGAAGTGCACGGTGGGCGATCGCTGGTCCAGTCAGCAGGGCAGCAAAGCAGTCTACCCAGAGGGGGACGGCAACTGGGCCAACTACAACACCTTTGGATCTGCAGAGGCGGCCACGAGCGATGACTACAAGAACCCTGGCTACTACGACATCCAGGCCAAGGACCTGGGCATCTGGCACGTGCCCAATAAGTCCCCCATGCAGCACTGGAGAAACAGCTCCCTGCTGAGGTACCGCACGGACACTGGCTTCCTCCAGACACTGGGACATAATCTGTTTGGCATCTACCAGAAATATCCAGTGAAATATGGAGAAGGAAAGTGTTGGACTGACAACGGCCCGGTGATCCCTGTGGTCTATGATTTTGGCGACGCCCAGAAAACAGCATCTTATTACTCACCCTATGGCCAGCGGGAATTCACTGCGGGATTTGTTCAGTTCAGGGTATTTAATAACGAGAGAGCAGCCAACGCCTTGTGTGCTGGAATGAGGGTCACCGGATGTAACACTGAGCACCACTGCATTGGTGGAGGAGGATACTTTCCAGAGGCCAGTCCCCAGCAGTGTGGAGATTTTTCTGGTTTTGATTGGAGTGGATATGGAACTCATGTTGGTTACAGCAGCAGCCGTGAGATAACTGAGGCAGCTGTGCTTCTATTCTATCGTTGA |
| ORF Protein Sequence | MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0290-Ab | Anti-ITLN1/ HL-1/ HL1 functional antibody |
| Target Antigen | GM-Tg-g-SE0290-Ag | ITLN1 protein |
| Cytokine | cks-Tg-g-GM-SE0290 | intelectin 1 (galactofuranose binding) (ITLN1) protein & antibody |
| ORF Viral Vector | pGMLP000058 | Human ITLN1 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001119 | Human ITLN1 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000058 | Human ITLN1 Lentivirus particle |
| ORF Viral Vector | vGMAD001119 | Human ITLN1 Adenovirus particle |
Target information
| Target ID | GM-SE0290 |
| Target Name | ITLN1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
55600 |
| Gene ID | 16429 (Mus musculus), 498284 (Rattus norvegicus), 55600 (Homo sapiens) |
| Gene Symbols & Synonyms | Itln1,ITLN1,Lfr,IntL,Itln,Itln2,Itln3,Itln5,Itlna,HL1,LFR,HL-1,INTL,ITLN,hIntL,omentin |
| Target Alternative Names | Endothelial lectin HL-1,Galactofuranose-binding lectin,HL-1,HL1,INTL,ITLN,ITLN-1,ITLN1,IntL,Intelectin-1,Intestinal lactoferrin receptor,Itln,Itln1,Itln2,Itln3,Itln5,Itlna,LFR,Lfr,Omentin,hIntL,omentin |
| Uniprot Accession |
O88310,Q8WWA0
Additional SwissProt Accessions: O88310,Q8WWA0 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSMUSG00000038209, ENSG00000179914 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


