Human FCER1G/FCRG ORF/cDNA clone-Adenovirus particle (NM_004106.2)
Cat. No.: vGMAD000910
Pre-made Human FCER1G/FCRG Adenovirus for FCER1G overexpression in-vitro and in-vivo. The FCER1G adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FCER1G-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
FcRγ/FCER1G/FCERG/FCER1G/FCRG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD000910 | Human FCER1G Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD000910 |
| Gene Name | FCER1G |
| Accession Number | NM_004106.2 |
| Gene ID | 2207 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 261 bp |
| Gene Alias | FCRG |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG |
| ORF Protein Sequence | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T95400-Ab | Anti-FCERG/ FCER1G/ FCRG monoclonal antibody |
| Target Antigen | GM-Tg-g-T95400-Ag | FCERG/FCER1G VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004456 | Human FCER1G Lentivirus plasmid |
| ORF Viral Vector | pGMAD000910 | Human FCER1G Adenovirus plasmid |
| ORF Viral Vector | vGMLP004456 | Human FCER1G Lentivirus particle |
| ORF Viral Vector | vGMAD000910 | Human FCER1G Adenovirus particle |
Target information
| Target ID | GM-T95400 |
| Target Name | FcRγ/FCER1G/FCERG |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2207 |
| Gene ID |
100034137 (Equus caballus), 101089236 (Felis catus), 14127 (Mus musculus), 2207 (Homo sapiens) 25441 (Rattus norvegicus), 282226 (Bos taurus), 403798 (Canis lupus familiaris), 720291 (Macaca mulatta) |
| Gene Symbols & Synonyms | FCER1G,Fcer1g,CD23,Fce1g,Ly-50,FcR[g],FcRgamma,FcR-gamma,FcepsilonRI,FCRG |
| Target Alternative Names | CD23,FCER1G,FCERG,FCRG,Fc receptor gamma-chain (FcRgamma),Fc-epsilon RI-gamma,FcR-gamma,FcR[g],FcRgamma,FcRγ,Fce1g,FcepsilonRI,Fcer1g,High affinity immunoglobulin epsilon receptor subunit gamma,IgE Fc receptor subunit gamma (FceRI gamma),Ly-50 |
| Uniprot Accession |
P20411,P20491,P30273,Q9BDR7
Additional SwissProt Accessions: P20491,P30273,P20411,Q9BDR7 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | Sphingolipid signaling pathway, Phospholipase D signaling pathway, Platelet activation, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, Fc epsilon RI signaling pathway, Tuberculosis, Asthma |
| Gene Ensembl | ENSMUSG00000058715, ENSG00000158869, ENSBTAG00000024503, ENSCAFG00845029387, ENSMMUG00000004512 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


